General Information of DBT (ID: ET0UH6R)
Name
Adenosine receptor A2a (AA2AR)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Adenosine A2A receptor; A2aR; ADORA2A; A2a Adenosine receptor; A(2A) adenosine receptor
Family G-protein coupled receptor (GPCR)  >>  G-protein coupled rhodopsin receptor (GPCR-A)
Organism
Homo sapiens (Human)
Gene Name ADORA2A Gene ID
135
UniProt ID AA2AR_HUMAN (click to find more protein-related data of this DBT)
TTD ID T77365 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Function
The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Receptor for adenosine.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Caffeine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 2480 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID AA2AR_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 50000 nM (tested by experiment) [2]
                   Tested Species Cavia porcellus (Guinea pig)
                   UniProt ID AA2AR_CAVPO
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 9400 nM (tested by experiment) [3]
                   Tested Species Rattus norvegicus (Rat)
                   UniProt ID AA2AR_RAT
References
1 Fluorescent ligands for adenosine receptors. Bioorg Med Chem Lett. 2013 Jan 1; 23(1):26-36.
2 Analogues of caffeine and theophylline: effect of structural alterations on affinity at adenosine receptors. J Med Chem. 1986 Jul; 29(7):1305-8.
3 Bioactive pyridoacridine alkaloids from the micronesian sponge Oceanapia sp. J Nat Prod. 1998 Feb; 61(2):301-5.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.