Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0V9KP) | |||||
|---|---|---|---|---|---|
| Name |
Alkaline phosphatase ALPL (ALPL)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Alkaline phosphatase liver/bone/kidney isozyme; Alkaline phosphatase, tissue-nonspecific isozyme; AP-TNAP; Liver/bone/kidney isozyme; TNSALP
|
||||
| Family | Hydrolase (HDase) >> Ester bond hydrolase (EC 3.1) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | ALPL | Gene ID | |||
| UniProt ID | PPBT_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T09538 | (click to find more therapeutic target data of this DBT) | |||
| INTEDE ID | DME0079 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG VKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDE KARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELN RNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG QAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYV PHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALALYPLSVLF |
||||
| Function |
This isozyme plays a key role in skeletal mineralization by regulating levels of diphosphate (PPi).
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Phenylalanine | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Solubilizing agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 100100 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | PPBT_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Coumarin sulfonates: New alkaline phosphatase inhibitors; in vitro and in silico studies. Eur J Med Chem. 2017 May 5; 131:29-47. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.