Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0W2VU) | |||||
---|---|---|---|---|---|
Name |
P2Y purinoceptor 4 (P2RY4)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Uridine nucleotide receptor; NRU; P2P; P2Y4; UNR
|
||||
Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | P2RY4 | Gene ID | |||
UniProt ID | P2RY4_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T82083 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLF
IFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLY CSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKG TTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGSAQSSSR LRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC LDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTP RADRL |
||||
Function |
Receptor for UTP and UDP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system. Not activated by ATP or ADP.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: D&C green no. 5 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 1910 nM (estimated based on the structural similarity with CHEMBL401859 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.934131737 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | P2RY4_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Development of Potent and Selective Antagonists for the UTP-Activated P2Y 4 Receptor. J Med Chem. 2017 Apr 13; 60(7):3020-3038. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.