Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0WE5D) | |||||
|---|---|---|---|---|---|
| Name |
Carbonic anhydrase XII (CA12)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Carbonate dehydratase XII; CA-XII; Tumor antigen HOM-RCC-3.1.3; ; Carbonic anhydrase 12
|
||||
| Family | Lyase/isomerase/ligase (L/I/G) >> Carbon-oxygen lyase (EC 4.2) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | CA12 | Gene ID | |||
| UniProt ID | CAH12_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T16987 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA |
||||
| Function |
Reversible hydration of carbon dioxide.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Benzosulfimide | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 633 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH12_HUMAN | |||||
| DIG Name: methylparaben | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 820 nM (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH12_HUMAN | |||||
| DIG Name: Saccharin sodium dihydrate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 633 nM (estimated based on the structural similarity with CHEMBL310671 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.962264151 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH12_HUMAN | |||||
| DIG Name: Ethylparaben | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 8600 nM (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH12_HUMAN | |||||
| DIG Name: Gentisic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 7300 nM (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH12_HUMAN | |||||
| DIG Name: Hydroquinone | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 7800 nM (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH12_HUMAN | |||||
| DIG Name: Phenol | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 9200 nM (tested by experiment) | [4] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH12_HUMAN | |||||
| DIG Name: Sodium cyclamate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 3.8 nM (tested by experiment) | [5] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH12_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

