Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0XE1S) | |||||
---|---|---|---|---|---|
Name |
Gamma-BBH hydroxylase (BBOX1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Gamma-butyrobetaine dioxygenase; Gamma-butyrobetaine hydroxylase; Gamma-BBH; Gamma-butyrobetaine,2-oxoglutarate dioxygenase
|
||||
Family | Oxidoreductase (ORase) >> Oxygen paired donor oxidoreductase (EC 1.14) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | BBOX1 | Gene ID | |||
UniProt ID | BODG_HUMAN | (click to find more protein-related data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDV
NIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSEL QLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHT WQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQK LKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIF DVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISR HLEGAYADWDVVMSRLRILRQRVENGN |
||||
Function |
Catalyzes the formation of L-carnitine from gamma-butyrobetaine.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Phenylmercuric acetate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 2600 nM (estimated based on the structural similarity with CHEMBL39469 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.766666667 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | BODG_HUMAN | |||||
DIG Name: Phenylmercuric borate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 39000 nM (estimated based on the structural similarity with CHEMBL3122204 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.844827586 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | BODG_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Ejection of structural zinc leads to inhibition of -butyrobetaine hydroxylase. Bioorg Med Chem Lett. 2014 Nov 1; 24(21):4954-7. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.