Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0XF2O) | |||||
|---|---|---|---|---|---|
| Name |
Glycine type-1 transporter (GlyT-1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Glycine transporter GlyT-1; GlyT-1; GlyT1; Glycine transporter type 1; Sodium- and chloride-dependent glycine transporter 1; Solute carrier family 6 member 9; SLC6A9
|
||||
| Family | Potential-driven transporter (PDT) >> Neurotransmitter:sodium symporter (NSS) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | SLC6A9 | Gene ID | |||
| UniProt ID | SC6A9_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T69685 | (click to find more therapeutic target data of this DBT) | |||
| VARIDT ID | DTD0461 | (click to find more drug transporter data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKV
WHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGL GNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKG VGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTN GSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLV VFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKV WGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETL VTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVIS CIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITY NHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLE HRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI |
||||
| Function |
May play a role in regulation of glycine levels in NMDA receptor-mediated neurotransmission. Terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Aminoethanoic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Buffering agent; Disintegrant; Lyophilization aid
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 31600 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | SC6A9_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Novel GlyT1 inhibitor chemotypes by scaffold hopping. Part 1: development of a potent and CNS penetrant [3.1.0]-based lead. Bioorg Med Chem Lett. 2014 Feb 15; 24(4):1067-70. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.