Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0XF2O) | |||||
---|---|---|---|---|---|
Name |
Glycine type-1 transporter (GlyT-1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Glycine transporter GlyT-1; GlyT-1; GlyT1; Glycine transporter type 1; Sodium- and chloride-dependent glycine transporter 1; Solute carrier family 6 member 9; SLC6A9
|
||||
Family | Potential-driven transporter (PDT) >> Neurotransmitter:sodium symporter (NSS) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | SLC6A9 | Gene ID | |||
UniProt ID | SC6A9_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T69685 | (click to find more therapeutic target data of this DBT) | |||
VARIDT ID | DTD0461 | (click to find more drug transporter data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKV
WHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGL GNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKG VGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTN GSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLV VFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKV WGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETL VTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVIS CIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITY NHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLE HRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI |
||||
Function |
May play a role in regulation of glycine levels in NMDA receptor-mediated neurotransmission. Terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Aminoethanoic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Buffering agent; Disintegrant; Lyophilization aid
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 31600 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SC6A9_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Novel GlyT1 inhibitor chemotypes by scaffold hopping. Part 1: development of a potent and CNS penetrant [3.1.0]-based lead. Bioorg Med Chem Lett. 2014 Feb 15; 24(4):1067-70. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.