General Information of DBT (ID: ET0Y4YM)
Name
Organic anion transporter 8 (OAT8)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Liver-specific organic anion transporter 2; Liver organic anion transporter 2; OATP-8; OATP1B3; OATP8; LST-2; LST2; Organic anion-transporting polypeptide 8; SLC21A8; Solute carrier family 21 member 8; Solute carrier organic anion transporter family member 1B3; SLCO1B3
Family Potential-driven transporter (PDT)  >>  Organo anion transporter (OAT)
Organism
Homo sapiens (Human)
Gene Name SLCO1B3 Gene ID
28234
UniProt ID SO1B3_HUMAN (click to find more protein-related data of this DBT)
TTD ID T02565 (click to find more therapeutic target data of this DBT)
VARIDT ID DTD0030 (click to find more drug transporter data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFD
ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGY
YRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNML
RGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFALGSLFAKMYVDIGYV
DLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLK
TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVF
KYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL
FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGIT
YLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAI
QVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCM
KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASD
NERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAAN
Function
Mediates the Na(+)-independent uptake of organic anions such as 17-beta-glucuronosyl estradiol, taurocholate, triiodothyronine (T3), leukotriene C4, dehydroepiandrosterone sulfate (DHEAS), methotrexate and sulfobromophthalein (BSP). Involved in the clearance of bile acids and organic anions from the liver.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Polyoxyl 35 castor oil Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.001 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1B3_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.0047 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1B3_HUMAN
          DIG Name: Hydroxyethyl-beta-cyclodextrin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.001 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1B3_HUMAN
          DIG Name: Polyoxyl 15 hydroxystearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.0019 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1B3_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.0087 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1B3_HUMAN
References
1 Pharmaceutical excipients influence the function of human uptake transporting proteins. Mol Pharm. 2012 Sep 4;9(9):2577-81.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.