Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0Z7CL) | |||||
|---|---|---|---|---|---|
| Name |
Autotaxin (ENPP2)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Extracellular lysophospholipase D; ATX; E-NPP 2; Ectonucleotide pyrophosphatase/phosphodiesterase family member 2; Extracellular lysophospholipase D; LysoPLD
|
||||
| Family | Hydrolase (HDase) >> Ester bond hydrolase (EC 3.1) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | ENPP2 | Gene ID | |||
| UniProt ID | ENPP2_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T63512 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCK
GRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHC SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMK KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA TFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHER PSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDH GMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH FKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNK VNSMQTVFVGYGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF RPTMPEEVTRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYG RPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVS PSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVL VKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQ PADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFR KTSRSYPEILTLKTYLHTYESEI |
||||
| Function |
Hydrolyzes lysophospholipids to produce the signaling molecule lysophosphatidic acid (LPA) in extracellular fluids. Major substrate is lysophosphatidylcholine. Also can act on sphingosylphosphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. Can hydrolyze, in vitro, bis-pNPP, to some extent pNP-TMP, and barely ATP. Involved in several motility-related processes such as angiogenesis and neurite outgrowth.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: D&C red no. 33 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 1260 nM (estimated based on the structural similarity with CHEMBL1091752 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.911111111 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ENPP2_HUMAN | |||||
| DIG Name: Naphthol blue black | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 28100 nM (estimated based on the structural similarity with CHEMBL1092081 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.917948718 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ENPP2_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Pharmacophore development and application toward the identification of novel, small-molecule autotaxin inhibitors. J Med Chem. 2010 Apr 22; 53(8):3095-105. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

