Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0ZY1P) | |||||
---|---|---|---|---|---|
Name |
Oxysterols receptor LXR-beta (NR1H2)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Liver X receptor beta; NER; Nuclear orphan receptor LXR-beta; LXRB; LXRbeta; Nuclear receptor NER; Nuclear receptor subfamily 1 group H member 2; Ubiquitously-expressed nuclear receptor
|
||||
Family |
Nuclear receptor (NR) >> Nuclear hormone receptor (NHR) |
||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | NR1H2 | Gene ID | |||
UniProt ID | NR1H2_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T13714 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE |
||||
Function |
Binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4). Regulates cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8; DLDLR and LRP8. Interplays functionally with RORA for the regulation of genes involved in liver metabolism. Plays an anti-inflammatory role during the hepatic acute phase response by acting as a corepressor: inhibits the hepatic acute phase response by preventing dissociation of the N-Cor corepressor complex.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Butylparaben | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 66000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | NR1H2_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Identify liver X receptor modulator building blocks by developing a fluorescence polarization-based competition assay. Eur J Med Chem. 2019 Sep 15; 178:458-467. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.