Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T59045
|
||||
| Former ID |
TTDS00024
|
||||
| Target Name |
4-aminobutyrate aminotransferase, mitochondrial
|
||||
| Gene Name |
ABAT
|
||||
| Synonyms |
(S)-3-amino-2-methylpropionate transaminase; GABA aminotransferase; GABA transaminase; GABA-AT; GABA-T; Gamma-amino-N-butyrate transaminase; L-AIBAT; ABAT
|
||||
| Target Type |
Successful
|
||||
| Disease | Dietary shortage [ICD9: 260-269; ICD10: E40-E46] | ||||
| Dietary shortage; Glioma [ICD9:260-269, 191; ICD10: E40-E46, C71] | |||||
| Dementia [ICD9: 290-294; ICD10: F01-F07] | |||||
| Epilepsy; Infantile spasms; Complex partial seizures [ICD9: 345, 345.4, 345.5, 345.9, 728.85, 780.3; ICD10: G40, G40.2, P90, R25.2, R56] | |||||
| Infantile spasms [ICD10: G40.4] | |||||
| Seizures [ICD9: 345.9, 780.3; ICD10: G40, P90, R56] | |||||
| Substance dependence [ICD10: F10-F19] | |||||
| Function |
Catalyzes the conversion of gamma-aminobutyrate and L- beta-aminoisobutyrate to succinate semialdehyde and methylmalonate semialdehyde, respectively. Can also convert delta-aminovalerate andbeta-alanine.
|
||||
| BioChemical Class |
Transferases of nitrogenous groups
|
||||
| Target Validation |
T59045
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.6.1.22
|
||||
| Sequence |
MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ NASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYR SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF RDHHAHLFLNIFSDILADFK |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Divalproex sodium | Drug Info | Approved | Seizures | [550982] |
| L-Alanine | Drug Info | Approved | Dietary shortage; Glioma | [542213], [550116], [551871] | |
| Pyridoxal Phosphate | Drug Info | Approved | Dietary shortage | [540717], [550672] | |
| Pyruvic acid | Drug Info | Approved | Dietary shortage | [468040], [538216] | |
| Vigabatrin | Drug Info | Approved | Epilepsy; Infantile spasms; Complex partial seizures | [468053], [530677] | |
| K-828-AB | Drug Info | Phase 2 | Dementia | [551074] | |
| CPP -15 | Drug Info | Phase 1 | Infantile spasms | [549894] | |
| CPP-115 | Drug Info | Phase 1 | Substance dependence | [523732], [543038] | |
| Inhibitor | (4e)-4-Aminohex-4-Enoic Acid | Drug Info | [551393] | ||
| 1-(4-hydroxyphenyl)prop-2-en-1-one | Drug Info | [527869] | |||
| 3-chloro-1-(4-hydroxyphenyl)propan-1-one | Drug Info | [529916] | |||
| 4-Amino Hexanoic Acid | Drug Info | [551393] | |||
| 4-hydroxy-3-nitrobenzaldehyde | Drug Info | [527869] | |||
| 4-hydroxybenzaldehyde | Drug Info | [529916] | |||
| 4-hydroxybenzylamine | Drug Info | [527869] | |||
| Acetate Ion | Drug Info | [551393] | |||
| CPP-115 | Drug Info | [549893] | |||
| Divalproex sodium | Drug Info | [536555] | |||
| Gamma-acetylenic GABA | Drug Info | [537793] | |||
| K-828-AB | Drug Info | [550353] | |||
| L-Alanine | Drug Info | [536555] | |||
| NIPECOTIC ACID | Drug Info | [533540] | |||
| OXAMATE | Drug Info | [533540] | |||
| Pyridoxal Phosphate | Drug Info | [536555] | |||
| Pyruvic acid | Drug Info | [536555] | |||
| Sodium valproate | Drug Info | [537744] | |||
| VANILLIN | Drug Info | [527869] | |||
| Vigabatrin | Drug Info | [530677], [535575], [536166], [537757] | |||
| Modulator | CPP -15 | Drug Info | [549893] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | GABA shunt | ||||
| Valine degradation | |||||
| Beta-alanine degradation | |||||
| 4-aminobutyrate degradation | |||||
| KEGG Pathway | Alanine, aspartate and glutamate metabolism | ||||
| Valine, leucine and isoleucine degradation | |||||
| beta-Alanine metabolism | |||||
| Propanoate metabolism | |||||
| Butanoate metabolism | |||||
| Metabolic pathways | |||||
| GABAergic synapse | |||||
| PANTHER Pathway | Aminobutyrate degradation | ||||
| Pyrimidine Metabolism | |||||
| Gamma-aminobutyric acid synthesis | |||||
| PathWhiz Pathway | Aspartate Metabolism | ||||
| Glutamate Metabolism | |||||
| Beta-Alanine Metabolism | |||||
| Valine, Leucine and Isoleucine Degradation | |||||
| Propanoate Metabolism | |||||
| WikiPathways | GABA synthesis, release, reuptake and degradation | ||||
| Alanine and aspartate metabolism | |||||
| References | |||||
| Ref 468040 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4809). | ||||
| Ref 468053 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4821). | ||||
| Ref 523732 | ClinicalTrials.gov (NCT01493596) A Safety, Tolerability and Pharmacokinetic Study of CPP-115. U.S. National Institutes of Health. | ||||
| Ref 538216 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 065200. | ||||
| Ref 540717 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5249). | ||||
| Ref 542213 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 720). | ||||
| Ref 527869 | Bioorg Med Chem Lett. 2006 Feb;16(3):592-5. Epub 2005 Nov 14.Inhibition of GABA shunt enzymes' activity by 4-hydroxybenzaldehyde derivatives. | ||||
| Ref 529916 | Bioorg Med Chem Lett. 2009 Feb 1;19(3):731-4. Epub 2008 Dec 11.Inactivation of GABA transaminase by 3-chloro-1-(4-hydroxyphenyl)propan-1-one. | ||||
| Ref 533540 | J Med Chem. 1982 Feb;25(2):113-6.Aminomethyl-1,2,4-benzothiadiazines as potential analogues of gamma-aminobutyric acid. Unexpected discovery of a taurine antagonist. | ||||
| Ref 535575 | Gamma-vinyl GABA, an irreversible inhibitor of GABA transaminase, alters the acquisition and expression of cocaine-induced sensitization in male rats. Synapse. 2002 Dec 15;46(4):240-50. | ||||
| Ref 536555 | DrugBank: a knowledgebase for drugs, drug actions and drug targets. Nucleic Acids Res. 2008 Jan;36(Database issue):D901-6. Epub 2007 Nov 29. | ||||
| Ref 537744 | Influence of a GABA transaminase inhibitor on central nervous system oxygen toxicity. Aviat Space Environ Med. 1978 Jul;49(7):877-9. | ||||
| Ref 537757 | Vigabatrin for refractory complex partial seizures: multicenter single-blind study with long-term follow-up. Neurology. 1987 Feb;37(2):184-9. | ||||
| Ref 537793 | Treatment of Huntington disease with gamma-acetylenic GABA an irreversible inhibitor of GABA-transaminase: increased CSF GABA and homocarnosine without clinical amelioration. Neurology. 1981 Feb;31(2):207-11. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
