Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T51452
|
||||
| Former ID |
TTDR01177
|
||||
| Target Name |
Gamma-aminobutyric-acid receptor alpha-2 subunit
|
||||
| Gene Name |
GABRA2
|
||||
| Synonyms |
GABA(A)Gamma-aminobutyric-acid receptor alpha-2 subunit precursor receptor; GABA-A receptor alpha 2; GABRA2
|
||||
| Target Type |
Discontinued
|
||||
| Disease | Alcohol use disorders [ICD9: 303; ICD10: F10.2] | ||||
| Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
|
||||
| BioChemical Class |
Neurotransmitter receptor
|
||||
| Target Validation |
T51452
|
||||
| UniProt ID | |||||
| Sequence |
MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPG
LGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASK IWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSC PLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVM TAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASV MIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRM SRIVFPVLFGTFNLVYWATYLNREPVLGVSP |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | (2E,4S)-4-ammoniopent-2-enoate | Drug Info | [533514] | ||
| (4R)-4-ammoniopentanoate | Drug Info | [533514] | |||
| (4S)-4-ammoniopentanoate | Drug Info | [533514] | |||
| 3-(benzyloxy)-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
| 3-(hexa-1,3-dienyloxy)-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
| 3-(isopentyloxy)-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
| 3-butoxy-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
| 3-Ethoxy-9H-beta-carboline | Drug Info | [534660] | |||
| 3-ethoxy-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
| 3-isobutoxy-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
| 3-propoxy-9H-pyrido[3,4-b]indole | Drug Info | [531188] | |||
| 5-[(1R)-1-ammonioethyl]isoxazol-3-olate | Drug Info | [533514] | |||
| 5-[(1S)-1-ammonioethyl]isoxazol-3-olate | Drug Info | [533514] | |||
| AMENTOFLAVONE | Drug Info | [526653] | |||
| Barbituric acid derivative | Drug Info | [551407] | |||
| Beta-Carboline-3-carboxylic acid t-butyl ester | Drug Info | [531188] | |||
| CGS-17867A | Drug Info | [527100] | |||
| CI-218872 | Drug Info | [531188] | |||
| Ethyl 6-iodo-9H-pyrido[3,4-b]indole-3-carboxylate | Drug Info | [531188] | |||
| Ethyl 9H-pyrido[3,4-b]indole-3-carboxylate | Drug Info | [531188] | |||
| GAMMA-AMINO-BUTANOIC ACID | Drug Info | [533580] | |||
| L-655708 | Drug Info | [527005] | |||
| Ro-151310 | Drug Info | [531044] | |||
| Ro-154513 | Drug Info | [534122] | |||
| Ro-4938581 | Drug Info | [530391] | |||
| RY-066 | Drug Info | [534718] | |||
| Sec-butyl 9H-pyrido[3,4-b]indole-3-carboxylate | Drug Info | [531188] | |||
| Modulator (allosteric modulator) | alpha3IA | Drug Info | [543809] | ||
| alpha5IA | Drug Info | [543809] | |||
| DMCM | Drug Info | [543809] | |||
| tetrahydrodeoxycorticosterone | Drug Info | [543809] | |||
| TP003 | Drug Info | [543809] | |||
| [11C]flumazenil | Drug Info | [543809] | |||
| [18F]fluoroethylflumazenil | Drug Info | [543809] | |||
| [3H]CGS8216 | Drug Info | [543809] | |||
| Agonist | isonipecotic acid | Drug Info | [543809] | ||
| piperidine-4-sulphonic acid | Drug Info | [543809] | |||
| [3H]muscimol | Drug Info | [543809] | |||
| Modulator | MK-0343 | Drug Info | |||
| MRK016 | Drug Info | ||||
| PF-4480682 | Drug Info | [550179] | |||
| Blocker (channel blocker) | TBPS | Drug Info | [543809] | ||
| [35S]TBPS | Drug Info | [543809] | |||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| Retrograde endocannabinoid signaling | |||||
| GABAergic synapse | |||||
| Morphine addiction | |||||
| Nicotine addiction | |||||
| Reactome | Ligand-gated ion channel transport | ||||
| GABA A receptor activation | |||||
| WikiPathways | Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | ||||
| Iron uptake and transport | |||||
| References | |||||
| Ref 526653 | Bioorg Med Chem Lett. 2003 Jul 21;13(14):2281-4.Semisynthetic preparation of amentoflavone: A negative modulator at GABA(A) receptors. | ||||
| Ref 527005 | J Med Chem. 2004 Mar 25;47(7):1807-22.3-phenyl-6-(2-pyridyl)methyloxy-1,2,4-triazolo[3,4-a]phthalazines and analogues: high-affinity gamma-aminobutyric acid-A benzodiazepine receptor ligands with alpha 2, alpha 3, and alpha 5-subtype binding selectivity over alpha 1. | ||||
| Ref 527100 | Bioorg Med Chem Lett. 2004 Jul 5;14(13):3441-4.2,5-Dihydropyrazolo[4,3-c]pyridin-3-ones: functionally selective benzodiazepine binding site ligands on the GABAA receptor. | ||||
| Ref 530391 | Bioorg Med Chem Lett. 2009 Oct 15;19(20):5940-4. Epub 2009 Aug 15.The discovery and unique pharmacological profile of RO4938581 and RO4882224 as potent and selective GABAA alpha5 inverse agonists for the treatment of cognitive dysfunction. | ||||
| Ref 531044 | Bioorg Med Chem. 2010 Nov 15;18(22):7731-8. Epub 2010 Jun 1.The GABA(A) receptor as a target for photochromic molecules. | ||||
| Ref 531188 | Bioorg Med Chem. 2010 Nov 1;18(21):7548-64. Epub 2010 Sep 29.Design, synthesis, and subtype selectivity of 3,6-disubstituted |A-carbolines at Bz/GABA(A)ergic receptors. SAR and studies directed toward agents for treatment of alcohol abuse. | ||||
| Ref 533514 | J Med Chem. 1981 Dec;24(12):1377-83.gamma-Aminobutyric acid agonists, antagonists, and uptake inhibitors. Design and therapeutic aspects. | ||||
| Ref 533580 | J Med Chem. 1980 Jun;23(6):702-4.New anticonvulsants: Schiff bases of gamma-aminobutyric acid and gamma-aminobutyramide. | ||||
| Ref 534122 | J Med Chem. 1996 Apr 26;39(9):1928-34.Synthesis and pharmacological properties of novel 8-substituted imidazobenzodiazepines: high-affinity, selective probes for alpha 5-containing GABAA receptors. | ||||
| Ref 534660 | J Med Chem. 1998 Jul 2;41(14):2537-52.Synthesis and evaluation of analogues of the partial agonist 6-(propyloxy)-4-(methoxymethyl)-beta-carboline-3-carboxylic acid ethyl ester (6-PBC) and the full agonist 6-(benzyloxy)-4-(methoxymethyl)-beta-carboline-3-carboxylic acid ethyl ester (Zk 93423) at wild type and recombinant GABAA receptors. | ||||
| Ref 534718 | J Med Chem. 1998 Oct 8;41(21):4130-42.Predictive models for GABAA/benzodiazepine receptor subtypes: studies of quantitative structure-activity relationships for imidazobenzodiazepines at five recombinant GABAA/benzodiazepine receptor subtypes [alphaxbeta3gamma2 (x = 1-3, 5, and 6)] via comparative molecular field analysis. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
