Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T27186
|
||||
| Former ID |
TTDC00176
|
||||
| Target Name |
Placenta growth factor
|
||||
| Gene Name |
PGF
|
||||
| Synonyms |
PlGF-131; PGF
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Macular degeneration [ICD9: 362.5; ICD10: H35.3] | ||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Growth factor active in angiogenesisand endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.
|
||||
| BioChemical Class |
Growth factor
|
||||
| Target Validation |
T27186
|
||||
| UniProt ID | |||||
| Sequence |
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL TFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWP SSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| KEGG Pathway | Ras signaling pathway | ||||
| Rap1 signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| Focal adhesion | |||||
| Pathways in cancer | |||||
| NetPath Pathway | TSH Signaling Pathway | ||||
| Pathway Interaction Database | VEGFR1 specific signals | ||||
| Reactome | VEGF ligand-receptor interactions | ||||
| VEGF binds to VEGFR leading to receptor dimerization | |||||
| WikiPathways | Focal Adhesion | ||||
| Signaling by VEGF | |||||
| References | |||||
| Ref 522356 | ClinicalTrials.gov (NCT00702494) Phase I Study on Monoclonal Antibody TB-403 Directed Against PlGF in Patients With Solid Tumours. U.S. National Institutes of Health. | ||||
| Ref 531341 | sFLT01: a novel fusion protein with antiangiogenic activity. Mol Cancer Ther. 2011 Mar;10(3):404-15. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
