Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T02532
|
||||
| Former ID |
TTDS00368
|
||||
| Target Name |
T-cell surface antigen CD2
|
||||
| Gene Name |
CD2
|
||||
| Synonyms |
Erythrocyte receptor; LFA-2; LFA-3 receptor; Rosette receptor; T-cell surface antigen T11/Leu-5; CD2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer; Psoriasis [ICD9: 140-229, 696; ICD10: L40] | ||||
| Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
| Function |
CD2 interacts with lymphocyte function-associated antigen (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T- cells, the cytoplasmic domain is implicated in the signaling function.
|
||||
| BioChemical Class |
Transmembrane protein
|
||||
| UniProt ID | |||||
| Sequence |
MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| KEGG Pathway | Cell adhesion molecules (CAMs) | ||||
| Hematopoietic cell lineage | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| Reactome | Cell surface interactions at the vascular wall | ||||
| WikiPathways | Cell surface interactions at the vascular wall | ||||
| References | |||||
| Ref 527770 | J Med Chem. 2005 Oct 6;48(20):6236-49.Structure-activity studies of peptides from the "hot-spot" region of human CD2 protein: development of peptides for immunomodulation. | ||||
| Ref 529900 | J Med Chem. 2009 Feb 12;52(3):726-36.Design of beta-hairpin peptides for modulation of cell adhesion by beta-turn constraint. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
