Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T78356
|
||||
| Former ID |
TTDC00086
|
||||
| Target Name |
Thromboxane-A synthase
|
||||
| Gene Name |
TBXAS1
|
||||
| Synonyms |
TS; TXA synthase; TXS; Thromboxane A2 synthase; TBXAS1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Angina pectoris [ICD9: 413; ICD10: I20] | ||||
| Asthma [ICD10: J45] | |||||
| Cardiac arrhythmias [ICD9: 427; ICD10: I47-I49] | |||||
| Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
| Nephritis [ICD10: N00-N19, N25-N29] | |||||
| Thromboembolism [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82] | |||||
| Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
| Thrombosis [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82] | |||||
| Unspecified [ICD code not available] | |||||
| BioChemical Class |
Intramolecular oxidoreductases
|
||||
| Target Validation |
T78356
|
||||
| UniProt ID | |||||
| EC Number |
EC 5.3.99.5
|
||||
| Sequence |
MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFR
QGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSV ADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQR CYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLA RILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIV RDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATN PDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEV LGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCL GVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | PYRIDINE | Drug Info | Phase 4 | Discovery agent | [524763] |
| NM-702 | Drug Info | Phase 3 | Angina pectoris | [544180] | |
| E-6700 | Drug Info | Phase 2 | Asthma | [534187] | |
| EV-077 | Drug Info | Phase 2 | Type 2 diabetes | [523832] | |
| FK-070 | Drug Info | Phase 2 | Angina pectoris | [534202] | |
| G-619 | Drug Info | Phase 1 | Thrombosis | [534091] | |
| NV-52 | Drug Info | Phase 1 | Inflammatory bowel disease | [547537] | |
| ONO-1301 | Drug Info | Preclinical | Angina pectoris | [539261], [545843] | |
| Satigrel | Drug Info | Discontinued in Preregistration | Thromboembolism | [544655] | |
| Imitrodast | Drug Info | Discontinued in Phase 2 | Asthma | [544584] | |
| MILACAINIDE TARTRATE | Drug Info | Discontinued in Phase 2 | Cardiac arrhythmias | [544939] | |
| Rolafagrel | Drug Info | Discontinued in Phase 2 | Nephritis | [544896] | |
| CGS-13080 | Drug Info | Terminated | Asthma | [544600] | |
| Dazoxiben | Drug Info | Terminated | Discovery agent | [468236], [544646] | |
| Inhibitor | 2-(10-Imidazol-1-yl-decyl)-isoindole-1,3-dione | Drug Info | [533459] | ||
| 2-(6-Imidazol-1-yl-hexyl)-isoindole-1,3-dione | Drug Info | [533459] | |||
| 2-(8-Imidazol-1-yl-octyl)-isoindole-1,3-dione | Drug Info | [533459] | |||
| 4-Methyl-pyridine | Drug Info | [533575] | |||
| 5-(2-Imidazol-1-yl-ethyl)-7,8-dihydro-quinoline | Drug Info | [525760] | |||
| 5-Imidazol-1-yl-5,6,7,8-tetrahydro-quinoline | Drug Info | [525760] | |||
| 6-Imidazol-1-yl-isoquinoline | Drug Info | [525760] | |||
| CGS-13080 | Drug Info | [533494] | |||
| Dazoxiben | Drug Info | [537729] | |||
| Imitrodast | Drug Info | [533430] | |||
| NM-702 | Drug Info | [536325] | |||
| NV-52 | Drug Info | [536468], [536703] | |||
| ONO-1581 | Drug Info | [551276] | |||
| PYRIDINE | Drug Info | [533575] | |||
| Rolafagrel | Drug Info | [529293] | |||
| Modulator | CV-6504.HCL | Drug Info | [537655] | ||
| E-6700 | Drug Info | [534187] | |||
| EV-077 | Drug Info | ||||
| FK-070 | Drug Info | [534202] | |||
| G-619 | Drug Info | [534091] | |||
| Satigrel | Drug Info | [534205] | |||
| Antagonist | MILACAINIDE TARTRATE | Drug Info | [534278] | ||
| Agonist | ONO-1301 | Drug Info | [531705] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | C20 prostanoid biosynthesis | ||||
| KEGG Pathway | Arachidonic acid metabolism | ||||
| Metabolic pathways | |||||
| Platelet activation | |||||
| PathWhiz Pathway | Arachidonic Acid Metabolism | ||||
| WikiPathways | Prostaglandin Synthesis and Regulation | ||||
| Arachidonic acid metabolism | |||||
| Phase 1 - Functionalization of compounds | |||||
| Eicosanoid Synthesis | |||||
| References | |||||
| Ref 468236 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5175). | ||||
| Ref 523832 | ClinicalTrials.gov (NCT01551381) Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of EV-077 in Type 2 Diabetic Subjects. U.S. National Institutes of Health. | ||||
| Ref 524763 | ClinicalTrials.gov (NCT02143167) Resistance Training and Amino Pyridine in Multiple Sclerosis. U.S. National Institutes of Health. | ||||
| Ref 534091 | G 619, a dual thromboxane synthase inhibitor and thromboxane A2 receptor antagonist, inhibits tumor necrosis factor-alpha biosynthesis. Eur J Pharmacol. 1995 Nov 3;286(1):31-9. | ||||
| Ref 534187 | Structure-activity relationships of (E)-3-(1,4-benzoquinonyl)-2-[(3-pyridyl)-alkyl]-2-propenoic acid derivatives that inhibit both 5-lipoxygenase and thromboxane A2 synthetase. J Med Chem. 1996 Aug 2;39(16):3148-57. | ||||
| Ref 534202 | Pharmacokinetic and pharmacodynamic properties of FK070 (KDI-792), a novel thromboxane receptor antagonist/thromboxane synthetase inhibitor, after single and multiple oral administrations to healthy volunteers. J Pharm Pharmacol. 1996 Apr;48(4):380-5. | ||||
| Ref 539261 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1964). | ||||
| Ref 544180 | Application of adaptive design and decision making to a phase II trial of a phosphodiesterase inhibitor for the treatment of intermittent claudication. Trials. 2011; 12: 134. | ||||
| Ref 544584 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000225) | ||||
| Ref 544600 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000262) | ||||
| Ref 544646 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000420) | ||||
| Ref 544655 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000441) | ||||
| Ref 544896 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001438) | ||||
| Ref 544939 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001597) | ||||
| Ref 525760 | J Med Chem. 2000 May 4;43(9):1841-51.1-imidazolyl(alkyl)-substituted di- and tetrahydroquinolines and analogues: syntheses and evaluation of dual inhibitors of thromboxane A(2) synthase and aromatase. | ||||
| Ref 529293 | Inhibition by FCE 22178 of platelet and glomerular thromboxane synthase in animal and human kidney disease. Adv Prostaglandin Thromboxane Leukot Res. 1991;21B:707-10. | ||||
| Ref 531705 | A synthetic prostacyclin agonist with thromboxane synthase inhibitory activity, ONO-1301, protects myocardium from ischemia/reperfusion injury. Eur J Pharmacol. 2012 Jan 15;674(2-3):352-8. | ||||
| Ref 533430 | RS-5186, a novel thromboxane synthetase inhibitor with a potent and extended duration of action. Thromb Res. 1988 Sep 1;51(5):507-20. | ||||
| Ref 533459 | J Med Chem. 1986 May;29(5):816-9.Thromboxane synthetase inhibitors and antihypertensive agents. 2. N-[(1H-imidazol-1-yl)alkyl]-1H-isoindole-1,3(2H)-diones and N-[(1H-1,2,4-triazol-1-yl)alkyl]-1H-isoindole-1,3(2H)-diones as unique antihypertensive agents. | ||||
| Ref 533494 | J Med Chem. 1985 Feb;28(2):164-70.Imidazo[1,5-a]pyridines: a new class of thromboxane A2 synthetase inhibitors. | ||||
| Ref 533575 | J Med Chem. 1981 Oct;24(10):1149-55.Highly selective inhibitors of thromboxane synthetase. 2. Pyridine derivatives. | ||||
| Ref 534091 | G 619, a dual thromboxane synthase inhibitor and thromboxane A2 receptor antagonist, inhibits tumor necrosis factor-alpha biosynthesis. Eur J Pharmacol. 1995 Nov 3;286(1):31-9. | ||||
| Ref 534187 | Structure-activity relationships of (E)-3-(1,4-benzoquinonyl)-2-[(3-pyridyl)-alkyl]-2-propenoic acid derivatives that inhibit both 5-lipoxygenase and thromboxane A2 synthetase. J Med Chem. 1996 Aug 2;39(16):3148-57. | ||||
| Ref 534202 | Pharmacokinetic and pharmacodynamic properties of FK070 (KDI-792), a novel thromboxane receptor antagonist/thromboxane synthetase inhibitor, after single and multiple oral administrations to healthy volunteers. J Pharm Pharmacol. 1996 Apr;48(4):380-5. | ||||
| Ref 534205 | Mechanisms of satigrel (E5510), a new anti-platelet drug, in inhibiting human platelet aggregation. Selectivity and potency against prostaglandin H synthases isozyme activities and phosphodiesterase isoform activities. Biol Pharm Bull. 1996 Jun;19(6):828-33. | ||||
| Ref 534278 | Effects of the new class I antiarrhythmic agent Ro 22-9194, (2R)-2-amino-N-(2,6-dimethylphenyl)-N-[3-(3-pyridyl)propyl]propionamide D-tartrate, on ischemia- and reperfusion-induced arrhythmias in dogs: involvement of thromboxane A2 synthase inhibitory activity. J Pharmacol Exp Ther. 1996 Nov;279(2):877-83. | ||||
| Ref 536325 | The novel phosphodiesterase inhibitor NM-702 improves claudication-limited exercise performance in patients with peripheral arterial disease. J Am Coll Cardiol. 2006 Dec 19;48(12):2539-45. Epub 2006Nov 28. | ||||
| Ref 536468 | Nv-52: a novel thromboxane synthase inhibitor for the treatment of inflammatory bowel disease. Expert Opin Investig Drugs. 2007 Aug;16(8):1255-66. | ||||
| Ref 536703 | Phase Ib single- and multiple-dose pharmacokinetic study of oral NV-52 in healthy volunteers. Drugs R D. 2008;9(3):159-66. | ||||
| Ref 537655 | Involvement of thromboxane A2, leukotrienes and free radicals in puromycin nephrosis in rats. Kidney Int. 1991 May;39(5):920-9. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
