Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T94309
|
||||
| Former ID |
TTDC00295
|
||||
| Target Name |
Triacylglycerol lipase, pancreatic
|
||||
| Gene Name |
PNLIP
|
||||
| Synonyms |
PL; Pancreatic lipase; PNLIP
|
||||
| Target Type |
Successful
|
||||
| Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
| Cystic fibrosis [ICD9: 277; ICD10: E84] | |||||
| Exocrine pancreatic insufficiency [ICD10: K86.8] | |||||
| Obesity [ICD9: 278; ICD10: E66] | |||||
| Pancreatic disease [ICD10: K85-K86] | |||||
| BioChemical Class |
Carboxylic ester hydrolase
|
||||
| Target Validation |
T94309
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.1.1.3
|
||||
| Sequence |
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Dalbavancin | Drug Info | Approved | Bacterial infections | [533123], [551871] |
| Orlistat | Drug Info | Approved | Obesity | [535886], [540740] | |
| Pancrecarb | Drug Info | NDA filed | Pancreatic disease | [550604] | |
| Liprotamase | Drug Info | Phase 3 | Cystic fibrosis | [522063] | |
| MS-1819 | Drug Info | Phase 1/2 | Exocrine pancreatic insufficiency | [548921] | |
| AZM-131 | Drug Info | Terminated | Obesity | [546516] | |
| Inhibitor | (Hydroxyethyloxy)Tri(Ethyloxy)Octane | Drug Info | [551393] | ||
| B-Nonylglucoside | Drug Info | [551374] | |||
| B-Octylglucoside | Drug Info | [551393] | |||
| Daio-Orengedokuto (DOT) | Drug Info | [535601] | |||
| Dalbavancin | Drug Info | [536589], [549974] | |||
| METHOXYUNDECYLPHOSPHINIC ACID | Drug Info | [551374] | |||
| Modulator | AZM-131 | Drug Info | [550117] | ||
| Liprotamase | Drug Info | [549848] | |||
| MS-1819 | Drug Info | [550329] | |||
| Orlistat | Drug Info | [556264] | |||
| Pancrecarb | Drug Info | [550604] | |||
| Pathways | |||||
| BioCyc Pathway | Triacylglycerol degradation | ||||
| Retinol biosynthesis | |||||
| KEGG Pathway | Glycerolipid metabolism | ||||
| Metabolic pathways | |||||
| Pancreatic secretion | |||||
| Fat digestion and absorption | |||||
| Vitamin digestion and absorption | |||||
| Reactome | Retinoid metabolism and transport | ||||
| WikiPathways | Visual phototransduction | ||||
| Lipid digestion, mobilization, and transport | |||||
| References | |||||
| Ref 522063 | ClinicalTrials.gov (NCT00500084) Phase III ALTU-135 CP Safety Trial. U.S. National Institutes of Health. | ||||
| Ref 535886 | Obesity and pharmacologic therapy. Endocrinol Metab Clin North Am. 2003 Dec;32(4):1005-24. | ||||
| Ref 540740 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5277). | ||||
| Ref 546516 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008694) | ||||
| Ref 535601 | Daio-Orengedokuto inhibits HMG-CoA reductase and pancreatic lipase. Biol Pharm Bull. 2002 Nov;25(11):1442-5. | ||||
| Ref 536589 | Dalbavancin: a novel once-weekly lipoglycopeptide antibiotic. Clin Infect Dis. 2008 Feb 15;46(4):577-83. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
