Target General Infomation
Target ID
T30823
Former ID
TTDR00202
Target Name
M-phase inducer phosphatase 1
Gene Name
CDC25A
Synonyms
Cdc25A phosphatase; Dual specificity phosphatase Cdc25A; CDC25A
Target Type
Discontinued
Disease Cancer [ICD9: 140-229; ICD10: C00-C96]
Function
Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Directly dephosphorylates CDK1 and stimulates its kinase activity. Also dephosphorylates CDK2 incomplex with cyclin E, in vitro.
BioChemical Class
Phosphoric monoester hydrolases
Target Validation
T30823
UniProt ID
EC Number
EC 3.1.3.48
Sequence
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK
RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP
ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL
WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI
SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY
CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
Drugs and Mode of Action
Drug(s) MX-7065 Drug Info Terminated Cancer [547465]
Inhibitor (E)-2-(1-decyl-2-oxoindolin-3-ylidene)acetic acid Drug Info [529444]
(Z)-2-(1-decyl-2-oxoindolin-3-ylidene)acetic acid Drug Info [529444]
1-dodecyl-1H-indole-2,3-dione Drug Info [529444]
2-(1-dodecyl-1H-indol-3-yl)acetic acid Drug Info [529444]
3-isopropyl-4-(phenylamino)naphthalene-1,2-dione Drug Info [527986]
3-isopropyl-4-(phenylthio)naphthalene-1,2-dione Drug Info [527986]
3-isopropyl-4-phenylnaphthalene-1,2-dione Drug Info [527986]
3-isopropylnaphthalene-1,2-dione Drug Info [527986]
4-(p-toluidino)-3-isopropylnaphthalene-1,2-dione Drug Info [527986]
MX-7065 Drug Info [551830]
Naphthoquinone analogs Drug Info [535050]
NSC-95397 Drug Info [530189]
Pathways
KEGG Pathway Cell cycle
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
NetPath Pathway IL4 Signaling Pathway
TGF_beta_Receptor Signaling Pathway
Pathway Interaction Database E2F transcription factor network
ATR signaling pathway
Validated targets of C-MYC transcriptional activation
ATM pathway
Reactome E2F mediated regulation of DNA replication
G0 and Early G1
Polo-like kinase mediated events
Cyclin B2 mediated events
Activation of ATR in response to replication stress
Cyclin E associated events during G1/S transition
G1/S-Specific Transcription
Cyclin A/B1 associated events during G2/M transition
Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
Cdk2-associated events at S phase entry
WikiPathways DNA Damage Response
G1 to S cell cycle control
S Phase
ATM Signaling Pathway
Retinoblastoma (RB) in Cancer
Prostate Cancer
Integrated Breast Cancer Pathway
Integrated Cancer pathway
Mitotic G1-G1/S phases
Cell Cycle
Cell Cycle Checkpoints
miRNAs involved in DNA damage response
miRNA Regulation of DNA Damage Response
References
Ref 547465Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016615)
Ref 527986Bioorg Med Chem Lett. 2006 Apr 1;16(7):1905-8. Epub 2006 Jan 24.Synthesis of miltirone analogues as inhibitors of Cdc25 phosphatases.
Ref 529444Bioorg Med Chem Lett. 2008 Jun 1;18(11):3350-3. Epub 2008 Apr 15.Design and synthesis of N-alkyl oxindolylidene acetic acids as a new class of potent Cdc25A inhibitors.
Ref 530189Bioorg Med Chem Lett. 2009 Aug 1;19(15):4330-4. Epub 2009 May 27.Structure-based de novo design and biochemical evaluation of novel Cdc25 phosphatase inhibitors.
Ref 535050Role of the Cdc25A phosphatase in human breast cancer. J Clin Invest. 2000 Sep;106(6):753-61.
Ref 551830Handbook of Assay Development in Drug Discovery, Lisa K. Minor, 2013. Page(11).

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.