Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T67619
|
||||
| Former ID |
TTDI00350
|
||||
| Target Name |
RAC serine/threonine-protein kinase
|
||||
| Gene Name |
AKT1
|
||||
| Synonyms |
PKB; PKB alpha; Protein kinase B; Protein kinase B alpha; Proto-oncogene c-Akt; RAC-PK-alpha; RAC-alpha serine/threonine-protein kinase; AKT1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Hematologic malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
| Myocardial reperfusion injury [ICD10: T86.4] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
AKT1-specific substrates have been recently identified, including palladin (PALLD), which phosphorylation modulates cytoskeletal organization and cell motility; prohibitin (PHB), playing an important role in cell metabolism and proliferation; and CDKN1A, for which phosphorylation at 'Thr-145' induces its release from CDK2 and cytoplasmic relocalization. These recent findings indicate that the AKT1 isoform has a more specific role in cell motility and proliferation. Phosphorylates CLK2 thereby controlling cell survival to ionizing radiation.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T46105
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.11.1
|
||||
| Sequence |
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA |
||||
| Structure |
1H10; 1UNP; 1UNQ; 1UNR; 2UVM; 2UZR; 2UZS; 3CQU; 3CQW; 3MV5; 3MVH; 3O96; 3OCB; 3OW4; 3QKK; 3QKL; 3QKM; 4EJN; 4EKK; 4EKL; 4GV1
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | CI-1033 | Drug Info | Phase 2 | Lymphoma | [525738], [541018] |
| CI-1040 | Drug Info | Phase 2 | Discovery agent | [521505], [541019] | |
| CMX-2043 | Drug Info | Phase 2 | Myocardial reperfusion injury | [524699] | |
| GSK2110183 | Drug Info | Phase 2 | Leukemia | [523646] | |
| RG7440 | Drug Info | Phase 2 | Solid tumours | [549061] | |
| RX-0201 | Drug Info | Phase 2 | Solid tumours | [522885] | |
| Trametinib + 2141795 | Drug Info | Phase 2 | Cancer | [524432] | |
| Triciribine prodrug | Drug Info | Phase 1/2 | Cancer | [524064] | |
| BMS-754807 | Drug Info | Phase 1 | Discovery agent | [522661], [542868] | |
| GDC-0068 | Drug Info | Phase 1 | Solid tumours | [542812], [550794] | |
| Inhibitor | (Z)-3-((1H-pyrrol-2-yl)methylene)indolin-2-one | Drug Info | [528864] | ||
| 4,5,6,7-tetrabromo-1H-benzo[d][1,2,3]triazole | Drug Info | [527308] | |||
| 4,5,6-trihydroxy-3-methylphthalide | Drug Info | [527356] | |||
| 4-[(3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol | Drug Info | [528490] | |||
| A-443654 | Drug Info | [528858] | |||
| A-674563 | Drug Info | [531679] | |||
| Akt inhibitor VIII | Drug Info | [527396] | |||
| AKT inhibitors [PMCID:PMC3086120] | Drug Info | [543423] | |||
| AKT protein kinase inhibitors | Drug Info | [543423] | |||
| ALM-301 | Drug Info | [543423] | |||
| ARRY-886 | Drug Info | [543423] | |||
| BISINDOLYLMALEIMIDE IX | Drug Info | [525872] | |||
| BMS-536924 | Drug Info | [527711] | |||
| BMS-754807 | Drug Info | [530403] | |||
| BX-517 | Drug Info | [528864] | |||
| CI-1033 | Drug Info | [536474] | |||
| CI-1040 | Drug Info | [525872] | |||
| compound 1 | Drug Info | [530572] | |||
| GDC-0068 | Drug Info | [550794] | |||
| GF-109203 | Drug Info | [525872] | |||
| Inositol 1,3,4,5-Tetrakisphosphate | Drug Info | [551393] | |||
| KN-62 | Drug Info | [525872] | |||
| Lactoquinomycin | Drug Info | [537458] | |||
| LD-101 | Drug Info | [543423] | |||
| MYRIOCIN | Drug Info | [529608] | |||
| RO-316233 | Drug Info | [525872] | |||
| RX-0201 | Drug Info | [550543] | |||
| SB-747651A | Drug Info | [529701] | |||
| STAUROSPORINONE | Drug Info | [525872] | |||
| Triciribine prodrug | Drug Info | [543423] | |||
| VLI-27 | Drug Info | [543423] | |||
| ZARAGOZIC ACIDS A | Drug Info | [529608] | |||
| Modulator | CMX-2043 | Drug Info | [532747] | ||
| GSK2110183 | Drug Info | [543423] | |||
| RG7440 | Drug Info | [550800] | |||
| Trametinib + 2141795 | Drug Info | [543423] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| ErbB signaling pathway | |||||
| Ras signaling pathway | |||||
| Rap1 signaling pathway | |||||
| cGMP-PKG signaling pathway | |||||
| cAMP signaling pathway | |||||
| Chemokine signaling pathway | |||||
| HIF-1 signaling pathway | |||||
| FoxO signaling pathway | |||||
| Sphingolipid signaling pathway | |||||
| mTOR signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| AMPK signaling pathway | |||||
| Apoptosis | |||||
| Adrenergic signaling in cardiomyocytes | |||||
| VEGF signaling pathway | |||||
| Osteoclast differentiation | |||||
| Focal adhesion | |||||
| Tight junction | |||||
| Signaling pathways regulating pluripotency of stem cells | |||||
| Platelet activation | |||||
| Toll-like receptor signaling pathway | |||||
| Jak-STAT signaling pathway | |||||
| T cell receptor signaling pathway | |||||
| B cell receptor signaling pathway | |||||
| Fc epsilon RI signaling pathway | |||||
| Fc gamma R-mediated phagocytosis | |||||
| TNF signaling pathway | |||||
| Neurotrophin signaling pathway | |||||
| Cholinergic synapse | |||||
| Dopaminergic synapse | |||||
| Insulin signaling pathway | |||||
| Progesterone-mediated oocyte maturation | |||||
| Estrogen signaling pathway | |||||
| Prolactin signaling pathway | |||||
| Thyroid hormone signaling pathway | |||||
| Adipocytokine signaling pathway | |||||
| Glucagon signaling pathway | |||||
| Regulation of lipolysis in adipocytes | |||||
| Non-alcoholic fatty liver disease (NAFLD) | |||||
| Carbohydrate digestion and absorption | |||||
| Chagas disease (American trypanosomiasis) | |||||
| Toxoplasmosis | |||||
| Tuberculosis | |||||
| Hepatitis C | |||||
| Hepatitis B | |||||
| Measles | |||||
| Influenza A | |||||
| HTLV-I infection | |||||
| Epstein-Barr virus infection | |||||
| Pathways in cancer | |||||
| Proteoglycans in cancer | |||||
| Colorectal cancer | |||||
| Renal cell carcinoma | |||||
| Pancreatic cancer | |||||
| Endometrial cancer | |||||
| Glioma | |||||
| Prostate cancer | |||||
| Melanoma | |||||
| Chronic myeloid leukemia | |||||
| Acute myeloid leukemia | |||||
| Small cell lung cancer | |||||
| Non-small cell lung cancer | |||||
| Central carbon metabolism in cancer | |||||
| Choline metabolism in cancer | |||||
| NetPath Pathway | TSH Signaling Pathway | ||||
| PANTHER Pathway | Angiogenesis | ||||
| Apoptosis signaling pathway | |||||
| EGF receptor signaling pathway | |||||
| Endothelin signaling pathway | |||||
| FGF signaling pathway | |||||
| Huntington disease | |||||
| Hypoxia response via HIF activation | |||||
| Inflammation mediated by chemokine and cytokine signaling pathway | |||||
| Insulin/IGF pathway-protein kinase B signaling cascade | |||||
| Interleukin signaling pathway | |||||
| PI3 kinase pathway | |||||
| T cell activation | |||||
| VEGF signaling pathway | |||||
| p53 pathway | |||||
| Ras Pathway | |||||
| p53 pathway by glucose deprivation | |||||
| p53 pathway feedback loops 2 | |||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | Regulation of nuclear SMAD2/3 signaling | ||||
| Fc-epsilon receptor I signaling in mast cells | |||||
| Endothelins | |||||
| BCR signaling pathway | |||||
| LPA receptor mediated events | |||||
| Insulin Pathway | |||||
| IL4-mediated signaling events | |||||
| TCR signaling in na& | |||||
| #xef | |||||
| ve CD4+ T cells | |||||
| Plasma membrane estrogen receptor signaling | |||||
| CD40/CD40L signaling | |||||
| Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met) | |||||
| Signaling events mediated by PTP1B | |||||
| S1P3 pathway | |||||
| Coregulation of Androgen receptor activity | |||||
| Reelin signaling pathway | |||||
| Integrin-linked kinase signaling | |||||
| TCR signaling in na& | |||||
| ve CD8+ T cells | |||||
| Angiopoietin receptor Tie2-mediated signaling | |||||
| FAS (CD95) signaling pathway | |||||
| Thromboxane A2 receptor signaling | |||||
| Regulation of Telomerase | |||||
| FOXA2 and FOXA3 transcription factor networks | |||||
| Glucocorticoid receptor regulatory network | |||||
| mTOR signaling pathway | |||||
| CXCR4-mediated signaling events | |||||
| IGF1 pathway | |||||
| FoxO family signaling | |||||
| IL2 signaling events mediated by PI3K | |||||
| Ceramide signaling pathway | |||||
| p75(NTR)-mediated signaling | |||||
| E-cadherin signaling in the nascent adherens junction | |||||
| amb2 Integrin signaling | |||||
| Integrins in angiogenesis | |||||
| IFN-gamma pathway | |||||
| ErbB1 downstream signaling | |||||
| ErbB2/ErbB3 signaling events | |||||
| IL6-mediated signaling events | |||||
| E-cadherin signaling in keratinocytes | |||||
| Nephrin/Neph1 signaling in the kidney podocyte | |||||
| Retinoic acid receptors-mediated signaling | |||||
| IL8- and CXCR2-mediated signaling events | |||||
| Signaling events mediated by the Hedgehog family | |||||
| Nongenotropic Androgen signaling | |||||
| Hedgehog signaling events mediated by Gli proteins | |||||
| Caspase Cascade in Apoptosis | |||||
| CXCR3-mediated signaling events | |||||
| VEGFR1 specific signals | |||||
| Signaling events mediated by Stem cell factor receptor (c-Kit) | |||||
| Signaling events mediated by VEGFR1 and VEGFR2 | |||||
| a6b1 and a6b4 Integrin signaling | |||||
| Aurora A signaling | |||||
| Insulin-mediated glucose transport | |||||
| Class I PI3K signaling events mediated by Akt | |||||
| IL8- and CXCR1-mediated signaling events | |||||
| HIF-1-alpha transcription factor network | |||||
| p53 pathway | |||||
| Trk receptor signaling mediated by PI3K and PLC-gamma | |||||
| VEGFR3 signaling in lymphatic endothelium | |||||
| FGF signaling pathway | |||||
| PathWhiz Pathway | Intracellular Signalling Through Adenosine Receptor A2a and Adenosine | ||||
| Intracellular Signalling Through Adenosine Receptor A2b and Adenosine | |||||
| Fc Epsilon Receptor I Signaling in Mast Cells | |||||
| Insulin Signalling | |||||
| Leucine Stimulation on Insulin Signaling | |||||
| Reactome | Activation of BAD and translocation to mitochondria | ||||
| GPVI-mediated activation cascade | |||||
| PIP3 activates AKT signaling | |||||
| Translocation of GLUT4 to the plasma membrane | |||||
| Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation | |||||
| AKT phosphorylates targets in the cytosol | |||||
| AKT phosphorylates targets in the nucleus | |||||
| Negative regulation of the PI3K/AKT network | |||||
| eNOS activation | |||||
| AKT-mediated inactivation of FOXO1A | |||||
| Integrin alphaIIb beta3 signaling | |||||
| Deactivation of the beta-catenin transactivating complex | |||||
| CD28 dependent PI3K/Akt signaling | |||||
| CTLA4 inhibitory signaling | |||||
| gamma signalling through PI3Kgamma | |||||
| KSRP (KHSRP) binds and destabilizes mRNA | |||||
| VEGFR2 mediated vascular permeability | |||||
| TP53 Regulates Metabolic Genes | |||||
| Constitutive Signaling by AKT1 E17K in Cancer | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| DNA Damage Response (only ATM dependent) | |||||
| TCR Signaling Pathway | |||||
| Notch Signaling Pathway | |||||
| EPO Receptor Signaling | |||||
| IL-2 Signaling Pathway | |||||
| Insulin Signaling | |||||
| Endochondral Ossification | |||||
| EGF/EGFR Signaling Pathway | |||||
| IL-4 Signaling Pathway | |||||
| TGF beta Signaling Pathway | |||||
| IL-6 signaling pathway | |||||
| Wnt Signaling Pathway Netpath | |||||
| Copper homeostasis | |||||
| Extracellular vesicle-mediated signaling in recipient cells | |||||
| Apoptosis-related network due to altered Notch3 in ovarian cancer | |||||
| IL-3 Signaling Pathway | |||||
| Cardiac Hypertrophic Response | |||||
| Translocation of GLUT4 to the Plasma Membrane | |||||
| Regulation of mRNA Stability by Proteins that Bind AU-rich Elements | |||||
| PIP3 activates AKT signaling | |||||
| Signal Transduction of S1P Receptor | |||||
| T-Cell Receptor and Co-stimulatory Signaling | |||||
| Primary Focal Segmental Glomerulosclerosis FSGS | |||||
| Apoptosis | |||||
| Alpha 6 Beta 4 signaling pathway | |||||
| BDNF signaling pathway | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Oncostatin M Signaling Pathway | |||||
| Corticotropin-releasing hormone | |||||
| Interleukin-11 Signaling Pathway | |||||
| AGE/RAGE pathway | |||||
| TNF alpha Signaling Pathway | |||||
| B Cell Receptor Signaling Pathway | |||||
| Prostate Cancer | |||||
| Signaling Pathways in Glioblastoma | |||||
| TSLP Signaling Pathway | |||||
| IL17 signaling pathway | |||||
| IL-7 Signaling Pathway | |||||
| Regulation of Microtubule Cytoskeleton | |||||
| TWEAK Signaling Pathway | |||||
| FSH signaling pathway | |||||
| Leptin signaling pathway | |||||
| TSH signaling pathway | |||||
| RANKL/RANK Signaling Pathway | |||||
| Integrated Breast Cancer Pathway | |||||
| SREBP signalling | |||||
| Integrated Cancer pathway | |||||
| IL-1 signaling pathway | |||||
| Metabolism of nitric oxide | |||||
| Integrin-mediated Cell Adhesion | |||||
| TFs Regulate miRNAs related to cardiac hypertrophy | |||||
| MicroRNAs in cardiomyocyte hypertrophy | |||||
| Angiogenesis | |||||
| TOR Signaling | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| AMPK Signaling | |||||
| Androgen receptor signaling pathway | |||||
| IL-5 Signaling Pathway | |||||
| References | |||||
| Ref 521505 | ClinicalTrials.gov (NCT00033384) CI-1040 in Treating Patients With Advanced Breast, Colon, Pancreatic, or Non-Small Cell Lung Cancer. U.S. National Institutes of Health. | ||||
| Ref 522661 | ClinicalTrials.gov (NCT00898716) Multiple Ascending Dose Study of BMS-754807 in Patients With Solid Tumors in Japan. U.S. National Institutes of Health. | ||||
| Ref 522885 | ClinicalTrials.gov (NCT01028495) A Safety and Efficacy Study of RX-0201 Plus Gemcitabine in Metastatic Pancreatic Cancer. U.S. National Institutes of Health. | ||||
| Ref 523646 | ClinicalTrials.gov (NCT01445587) A Study of GSK2110183 in Subjects With Proteasome Inhibitor Refractory Multiple Myeloma. U.S. National Institutes of Health. | ||||
| Ref 524064 | ClinicalTrials.gov (NCT01690468) Triciribine and Carboplatin in Ovarian Cancer. U.S. National Institutes of Health. | ||||
| Ref 524432 | ClinicalTrials.gov (NCT01941927) Trametinib With GSK2141795 in BRAF Wild-type Melanoma. U.S. National Institutes of Health. | ||||
| Ref 524699 | ClinicalTrials.gov (NCT02103959) Safety and Efficacy of CMX-2043 for Protection of the Heart and Kidneys in Subjects Undergoing Coronary Angiography. U.S. National Institutes of Health. | ||||
| Ref 525738 | Tyrosine kinase inhibitors. 17. Irreversible inhibitors of the epidermal growth factor receptor: 4-(phenylamino)quinazoline- and 4-(phenylamino)pyrido[3,2-d]pyrimidine-6-acrylamides bearing additional solubilizing functions. J Med Chem. 2000 Apr 6;43(7):1380-97. | ||||
| Ref 541018 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5675). | ||||
| Ref 541019 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5676). | ||||
| Ref 542812 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7887). | ||||
| Ref 542868 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7952). | ||||
| Ref 525872 | Biochem J. 2000 Oct 1;351(Pt 1):95-105.Specificity and mechanism of action of some commonly used protein kinase inhibitors. | ||||
| Ref 527308 | J Med Chem. 2004 Dec 2;47(25):6239-47.Optimization of protein kinase CK2 inhibitors derived from 4,5,6,7-tetrabromobenzimidazole. | ||||
| Ref 527356 | J Nat Prod. 2004 Dec;67(12):2086-9.A phthalide with in vitro growth inhibitory activity from an oidiodendron strain. | ||||
| Ref 527396 | Allosteric Akt (PKB) inhibitors: discovery and SAR of isozyme selective inhibitors. Bioorg Med Chem Lett. 2005 Feb 1;15(3):761-4. | ||||
| Ref 527711 | J Med Chem. 2005 Sep 8;48(18):5639-43.Discovery of a (1H-benzoimidazol-2-yl)-1H-pyridin-2-one (BMS-536924) inhibitor of insulin-like growth factor I receptor kinase with in vivo antitumor activity. | ||||
| Ref 528490 | J Med Chem. 2006 Nov 2;49(22):6500-9.4-arylazo-3,5-diamino-1H-pyrazole CDK inhibitors: SAR study, crystal structure in complex with CDK2, selectivity, and cellular effects. | ||||
| Ref 528858 | J Med Chem. 2007 Jun 28;50(13):2990-3003. Epub 2007 May 25.Syntheses of potent, selective, and orally bioavailable indazole-pyridine series of protein kinase B/Akt inhibitors with reduced hypotension. | ||||
| Ref 528864 | Bioorg Med Chem Lett. 2007 Jul 15;17(14):3814-8. Epub 2007 Apr 27.Indolinone based phosphoinositide-dependent kinase-1 (PDK1) inhibitors. Part 1: design, synthesis and biological activity. | ||||
| Ref 529608 | Nat Chem Biol. 2008 Sep;4(9):538-47. Epub 2008 Jul 20.Raft nanodomains contribute to Akt/PKB plasma membrane recruitment and activation. | ||||
| Ref 529701 | J Med Chem. 2008 Sep 25;51(18):5663-79.Identification of 4-(2-(4-amino-1,2,5-oxadiazol-3-yl)-1-ethyl-7-{[(3S)-3-piperidinylmethyl]oxy}-1H-imidazo[4,5-c]pyridin-4-yl)-2-methyl-3-butyn-2-ol (GSK690693), a novel inhibitor of AKT kinase. | ||||
| Ref 530403 | J Med Chem. 2009 Dec 10;52(23):7360-3.Discovery of a 2,4-disubstituted pyrrolo[1,2-f][1,2,4]triazine inhibitor (BMS-754807) of insulin-like growth factor receptor (IGF-1R) kinase in clinical development. | ||||
| Ref 530572 | 2,3,5-Trisubstituted pyridines as selective AKT inhibitors. Part II: Improved drug-like properties and kinase selectivity from azaindazoles. Bioorg Med Chem Lett. 2010 Jan 15;20(2):679-83. | ||||
| Ref 531679 | Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol. 2011 Oct 30;29(11):1046-51. | ||||
| Ref 532747 | Pre-clinical and Clinical Safety Studies of CMX-2043: a cytoprotective lipoic acid analogue for ischaemia-reperfusion injury. Basic Clin Pharmacol Toxicol. 2014 Nov;115(5):456-64. | ||||
| Ref 536474 | A comparison of physicochemical property profiles of marketed oral drugs and orally bioavailable anti-cancer protein kinase inhibitors in clinical development. Curr Top Med Chem. 2007;7(14):1408-22. | ||||
| Ref 537458 | The PI3K/Akt pathway as a target in the treatment of hematologic malignancies. Anticancer Agents Med Chem. 2009 Jun;9(5):550-9. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
