Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T06671
|
||||
| Former ID |
TTDC00221
|
||||
| Target Name |
Interleukin-18
|
||||
| Gene Name |
IL18
|
||||
| Synonyms |
IFN-gamma-inducing factor; IL-1 gamma; IL-18; Interferon-gamma inducing factor; Interleukin-1 gamma; IL18
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | B-cell non-hodgkin's lymphoma; Rheumatoid arthritis [ICD9: 200, 202, 202.8, 710-719, 714; ICD10: C81-C86, C82-C85, M00-M25, M05-M06] | ||||
| Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
| Non-hodgkin's lymphoma; Ovarian cancer [ICD9:183; ICD10: C85, C56] | |||||
| Non-hodgkin's lymphoma; Follicular lymphoma [ICD9: 200, 202, 202.0, 202.8; ICD10: C81-C86, C82, C82-C85] | |||||
| Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
| Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
| Function |
Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
|
||||
| BioChemical Class |
Cytokine: interleukin
|
||||
| Target Validation |
T06671
|
||||
| UniProt ID | |||||
| Sequence |
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL GDRSIMFTVQNED |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | GSK-1070806 | Drug Info | Phase 2 | Type 2 diabetes | [523987] |
| Iboctadekin | Drug Info | Phase 1 | Non-hodgkin's lymphoma; Ovarian cancer | [546479] | |
| Iboctadekin + Doxil | Drug Info | Phase 1 | Ovarian cancer | [522292], [550972] | |
| Iboctadekin + rituximab | Drug Info | Phase 1 | Non-hodgkin's lymphoma; Follicular lymphoma | [549706] | |
| MEDI-2338 | Drug Info | Phase 1 | Chronic obstructive pulmonary disease | [523408] | |
| IL-18BP | Drug Info | Discontinued in Phase 1 | B-cell non-hodgkin's lymphoma; Rheumatoid arthritis | [547123] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| NOD-like receptor signaling pathway | |||||
| Cytosolic DNA-sensing pathway | |||||
| Salmonella infection | |||||
| Legionellosis | |||||
| African trypanosomiasis | |||||
| Malaria | |||||
| Tuberculosis | |||||
| Influenza A | |||||
| Inflammatory bowel disease (IBD) | |||||
| Rheumatoid arthritis | |||||
| NetPath Pathway | IL4 Signaling Pathway | ||||
| PANTHER Pathway | Interleukin signaling pathway | ||||
| Toll receptor signaling pathway | |||||
| Pathway Interaction Database | IL27-mediated signaling events | ||||
| IL12-mediated signaling events | |||||
| IL23-mediated signaling events | |||||
| Cellular roles of Anthrax toxin | |||||
| IL12 signaling mediated by STAT4 | |||||
| Reactome | Interleukin-1 processing | ||||
| WikiPathways | Hypertrophy Model | ||||
| IL1 and megakaryotyces in obesity | |||||
| Corticotropin-releasing hormone | |||||
| NOD pathway | |||||
| References | |||||
| Ref 522292 | ClinicalTrials.gov (NCT00659178) Combination Study Of SB-485232 (Interleukin 18) And Doxil For Advanced Stage Epithelial Ovarian Cancer. U.S. National Institutes of Health. | ||||
| Ref 523408 | ClinicalTrials.gov (NCT01322594) A Study to Evaluate the Safety of MEDI2338 in Subjects With Chronic Obstructive Pulmonary Disease. U.S. National Institutes of Health. | ||||
| Ref 523987 | ClinicalTrials.gov (NCT01648153) Investigate the Efficacy and Safety of GSK1070806 in Obese Subjects With T2DM. U.S. National Institutes of Health. | ||||
| Ref 546479 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008435) | ||||
| Ref 544164 | Targeting the IL-1 family members in skin inflammation. Curr Opin Investig Drugs. 2010 November; 11(11): 1211-1220. | ||||
| Ref 544401 | Cytokine inhibition in the treatment of COPD. Int J Chron Obstruct Pulmon Dis. 2014; 9: 397-412. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
