Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T75256
|
||||
| Former ID |
TTDI02120
|
||||
| Target Name |
MART-1 melanoma antigen
|
||||
| Gene Name |
MLANA
|
||||
| Synonyms |
Antigen LB39AA; Antigen SK29AA; MART1; Melanoma antigen recognized by Tcells 1; Protein MelanA; MLANA
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Melanoma [ICD9: 172; ICD10: C43] | ||||
| Function |
Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.
|
||||
| BioChemical Class |
Melanoma antigen recognized by T cells 1
|
||||
| UniProt ID | |||||
| Sequence |
MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Melanoma vaccine | Drug Info | Phase 3 | Melanoma | [521514] |
| Multi-epitope peptide melanoma vaccine | Drug Info | Phase 3 | Melanoma | [521514] | |
| MKC-1106-MT | Drug Info | Phase 2 | Melanoma | [522880] | |
| Polynoma-1 | Drug Info | Phase 2 | Melanoma | [551529] | |
| Melanoma vaccine | Drug Info | Discontinued in Phase 2 | Melanoma | [547218] | |
| F-50040 | Drug Info | Discontinued in Phase 1 | Melanoma | [547414] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| References | |||||
| Ref 521514 | ClinicalTrials.gov (NCT00036816) Vaccine Therapy in Treating Patients With Melanoma of the Eye. U.S. National Institutes of Health. | ||||
| Ref 522880 | ClinicalTrials.gov (NCT01026051) Safety, Immune and Tumor Response to a Multi-component Immune Based Therapy (MKC1106-MT) for Patients With Melanoma. U.S. National Institutes of Health. | ||||
| Ref 547218 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014153) | ||||
| Ref 526271 | Stability and CTL-activity of P40/ELA melanoma vaccine candidate. Biologicals. 2001 Sep-Dec;29(3-4):293-8. | ||||
| Ref 531162 | Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58. | ||||
| Ref 544270 | Safety and immunogenicity of vaccination with MART-1 (26-35, 27L), gp100 (209-217, 210M), and tyrosinase (368-376, 370D) in-adjuvant with PF-3512676 and GM-CSF in metastatic melanoma. Correction in: volume 35 on page 650. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
