Target General Infomation
Target ID
T16650
Former ID
TTDR00389
Target Name
Glycoprotein hormones alpha chain
Gene Name
CGA
Synonyms
CG-alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin alpha subunit; FSH-alpha; Follicle-stimulating hormone alpha chain; Follitropin alpha chain; LSH-alpha; Luteinizing hormone alpha chain; Lutropin alpha chain; TSH-alpha; Thyroid-stimulating hormone alpha chain; Thyrotropin alpha chain; CGA
Target Type
Research
BioChemical Class
Glycoprotein hormones
UniProt ID
Sequence
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Inhibitor Alpha-D-Mannose Drug Info [551393]
Pathways
KEGG Pathway Neuroactive ligand-receptor interaction
GnRH signaling pathway
Ovarian steroidogenesis
Prolactin signaling pathway
Thyroid hormone synthesis
Autoimmune thyroid disease
PANTHER Pathway Thyrotropin-releasing hormone receptor signaling pathway
Pathway Interaction Database Glucocorticoid receptor regulatory network
PathWhiz Pathway Intracellular Signalling Through FSH Receptor and Follicle Stimulating Hormone
Intracellular Signalling Through LHCGR Receptor and Luteinizing Hormone/Choriogonadotropin
Reactome Androgen biosynthesis
Thyroxine biosynthesis
Hormone ligand-binding receptors
G alpha (s) signalling events
WikiPathways Metabolism of steroid hormones and vitamin D
Metabolism of amino acids and derivatives
Peptide hormone biosynthesis
FSH signaling pathway
TSH signaling pathway
Thyroxine (Thyroid Hormone) Production
GPCR ligand binding
GPCR downstream signaling
References
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.