Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T84117
|
||||
| Former ID |
TTDR00564
|
||||
| Target Name |
5-hydroxytryptamine 1E receptor
|
||||
| Gene Name |
HTR1E
|
||||
| Synonyms |
5-HT 1E; 5-HT-1E; 5-HT1E; S31; Serotonin receptor; Serotonin receptor 1E; HTR1E
|
||||
| Target Type |
Research
|
||||
| Function |
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various alkaloids and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| UniProt ID | |||||
| Sequence |
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR CREHT |
||||
| Antagonist | 1-naphthylpiperazine | Drug Info | [526943] | ||
| 9-OH-risperidone | Drug Info | [534281] | |||
| metergoline | Drug Info | [526943] | |||
| Agonist | 2-methyl-5-HT | Drug Info | [534001] | ||
| 5-BODMT | Drug Info | [531404] | |||
| 5-CT | Drug Info | [526943] | |||
| 5-fluorotryptamine | Drug Info | [526943] | |||
| alpha-methyl-5-HT | Drug Info | [526943] | |||
| B173 | Drug Info | [551688] | |||
| BRL-15572 | Drug Info | [534475] | |||
| BRL54443 | Drug Info | [535132] | |||
| EMDT | Drug Info | [525722] | |||
| lysergol | Drug Info | [534239] | |||
| m-chlorophenylpiperazine | Drug Info | [526943] | |||
| TFMPP | Drug Info | [526943] | |||
| [3H]5-HT | Drug Info | [527679] | |||
| Pathways | |||||
| KEGG Pathway | cAMP signaling pathway | ||||
| Neuroactive ligand-receptor interaction | |||||
| Serotonergic synapse | |||||
| PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
| 5HT1 type receptor mediated signaling pathway | |||||
| Reactome | Serotonin receptors | ||||
| G alpha (i) signalling events | |||||
| WikiPathways | Serotonin HTR1 Group and FOS Pathway | ||||
| Monoamine GPCRs | |||||
| GPCRs, Class A Rhodopsin-like | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 525722 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | ||||
| Ref 526943 | Molecular cloning and pharmacological characterization of the guinea pig 5-HT1E receptor. Eur J Pharmacol. 2004 Jan 26;484(2-3):127-39. | ||||
| Ref 527679 | Molecular cloning of a serotonin receptor from human brain (5HT1E): a fifth 5HT1-like subtype. Proc Natl Acad Sci U S A. 1992 Jun 15;89(12):5517-21. | ||||
| Ref 531404 | Toward selective drug development for the human 5-hydroxytryptamine 1E receptor: a comparison of 5-hydroxytryptamine 1E and 1F receptor structure-affinity relationships. J Pharmacol Exp Ther. 2011 Jun;337(3):860-7. | ||||
| Ref 534001 | Cloning of another human serotonin receptor (5-HT1F): a fifth 5-HT1 receptor subtype coupled to the inhibition of adenylate cyclase. Proc Natl Acad Sci U S A. 1993 Jan 15;90(2):408-12. | ||||
| Ref 534239 | Two amino acid differences in the sixth transmembrane domain are partially responsible for the pharmacological differences between the 5-HT1D beta and 5-HT1E 5-hydroxytryptamine receptors. J Neurochem. 1996 Nov;67(5):2096-103. | ||||
| Ref 534281 | Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73. | ||||
| Ref 534475 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
