Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T94400
|
||||
| Former ID |
TTDR00929
|
||||
| Target Name |
Thymidine monophosphate kinase
|
||||
| Gene Name |
tmk
|
||||
| Synonyms |
DTMPkinase; Deoxythymidine 5'-monophosphate kinase; TMPK; Thymidine 5'-monophosphate kinase; Thymidylate kinase; Thymidylate monophosphate kinase; Thymidylic acid kinase; Thymidylic kinase; tmk
|
||||
| Target Type |
Research
|
||||
| Function |
Catalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor. Situated at the junction of both de novo and salvage pathways of deoxythymidine triphosphate (dTTP) synthesis, is essential for DNA synthesis and cellular growth. Has a broad specificity for nucleoside triphosphates, being highly active withATP or dATP as phosphate donors, and less active with ITP, GTP, CTP and UTP.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T94400
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.4.9
|
||||
| Sequence |
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS |
||||
| Inhibitor | 2',3'-Dideoxythymidine-5'-Monophosphate | Drug Info | [551393] | ||
| 3'-Azido-3'-Deoxythymidine-5'-Monophosphate | Drug Info | [551393] | |||
| 5'-amino-5'-deoxy-alpha-D-thymidine | Drug Info | [529076] | |||
| 5'-deoxythymidine | Drug Info | [537773] | |||
| 5-Hydroxymethyluridine-2'-Deoxy-5'-Monophosphate | Drug Info | [551393] | |||
| Acetate Ion | Drug Info | [551393] | |||
| Adenosine-5'-Diphosphate | Drug Info | [551391] | |||
| BROMODEOXYURIDINE | Drug Info | [529464] | |||
| CHLORODEOXYURIDINE | Drug Info | [529464] | |||
| Deoxythymidine | Drug Info | [551393] | |||
| Diphosphate | Drug Info | [551393] | |||
| P1-(5'-Adenosyl)P5-(5'-Thymidyl)Pentaphosphate | Drug Info | [551391] | |||
| Phosphoaminophosphonic Acid-Adenylate Ester | Drug Info | [551374] | |||
| Thymidine-5'-Phosphate | Drug Info | [551393] | |||
| Thymidine-5'-Triphosphate | Drug Info | [551393] | |||
| Pathways | |||||
| KEGG Pathway | Pyrimidine metabolism | ||||
| Metabolic pathways | |||||
| References | |||||
| Ref 529076 | J Med Chem. 2007 Nov 1;50(22):5281-92. Epub 2007 Oct 2.Rational design of 5'-thiourea-substituted alpha-thymidine analogues as thymidine monophosphate kinase inhibitors capable of inhibiting mycobacterial growth. | ||||
| Ref 529464 | Bioorg Med Chem. 2008 Jun 1;16(11):6075-85. Epub 2008 Apr 25.Substituted benzyl-pyrimidines targeting thymidine monophosphate kinase of Mycobacterium tuberculosis: synthesis and in vitro anti-mycobacterial activity. | ||||
| Ref 537773 | Thymidylate kinase as target enzyme for 5'-deoxythymidine and various 5'-deoxy-5'-halogeno pyrimidine nucleosides. Acta Biol Med Ger. 1969;23(6):Suppl:K 19+. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
