Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T98459
|
||||
| Former ID |
TTDR00152
|
||||
| Target Name |
G2/mitotic-specific cyclin B1
|
||||
| Gene Name |
CCNB1
|
||||
| Synonyms |
Cyclin B1; CCNB1
|
||||
| Target Type |
Research
|
||||
| Function |
Essential for the control of the cell cycle at the G2/M (mitosis) transition.
|
||||
| Target Validation |
T98459
|
||||
| UniProt ID | |||||
| Sequence |
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS ALVQDLAKAVAKV |
||||
| Inhibitor | 3,4-bis(indol-3-yl)maleimide derivative | Drug Info | [534788] | ||
| 3,4-di-(4-methoxyphenyl)-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
| 3,4-diphenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
| 3-(4-methoxyphenyl)-4-phenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
| 3-(indole-3-yl)-4-phenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
| 4-(Quinolin-3-yl)-N-p-tolylpyrimidin-2-amine | Drug Info | [530491] | |||
| 4-(Quinolin-4-yl)-N-p-tolylpyrimidin-2-amine | Drug Info | [530491] | |||
| AZAKENPAULLONE | Drug Info | [526916] | |||
| GF-109203 | Drug Info | [534788] | |||
| KENPAULLONE | Drug Info | [531040] | |||
| RO-316233 | Drug Info | [534788] | |||
| Thieno analogue of kenpaullone | Drug Info | [526916] | |||
| Pathways | |||||
| KEGG Pathway | FoxO signaling pathway | ||||
| Cell cycle | |||||
| Oocyte meiosis | |||||
| p53 signaling pathway | |||||
| Progesterone-mediated oocyte maturation | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| PANTHER Pathway | p53 pathway | ||||
| Pathway Interaction Database | p73 transcription factor network | ||||
| Validated targets of C-MYC transcriptional activation | |||||
| PLK1 signaling events | |||||
| FoxO family signaling | |||||
| Direct p53 effectors | |||||
| FOXM1 transcription factor network | |||||
| C-MYB transcription factor network | |||||
| Reactome | Polo-like kinase mediated events | ||||
| Golgi Cisternae Pericentriolar Stack Reorganization | |||||
| Regulation of APC/C activators between G1/S and early anaphase | |||||
| Phosphorylation of the APC/C | |||||
| Phosphorylation of Emi1 | |||||
| Condensation of Prophase Chromosomes | |||||
| MASTL Facilitates Mitotic Progression | |||||
| Resolution of Sister Chromatid Cohesion | |||||
| Condensation of Prometaphase Chromosomes | |||||
| Regulation of PLK1 Activity at G2/M Transition | |||||
| Activation of NIMA Kinases NEK9, NEK6, NEK7 | |||||
| Recruitment of NuMA to mitotic centrosomes | |||||
| Depolymerisation of the Nuclear Lamina | |||||
| Cyclin A/B1 associated events during G2/M transition | |||||
| G2/M DNA replication checkpoint | |||||
| Cdk1 complex | |||||
| WikiPathways | DNA Damage Response | ||||
| G1 to S cell cycle control | |||||
| Mitotic Prophase | |||||
| Mitotic Prometaphase | |||||
| ATM Signaling Pathway | |||||
| Retinoblastoma (RB) in Cancer | |||||
| Mitotic G2-G2/M phases | |||||
| Mitotic G1-G1/S phases | |||||
| Cell Cycle | |||||
| APC/C-mediated degradation of cell cycle proteins | |||||
| Cell Cycle Checkpoints | |||||
| miRNA Regulation of DNA Damage Response | |||||
| AMPK Signaling | |||||
| References | |||||
| Ref 526916 | Bioorg Med Chem Lett. 2004 Jan 19;14(2):413-6.1-Azakenpaullone is a selective inhibitor of glycogen synthase kinase-3 beta. | ||||
| Ref 528032 | J Med Chem. 2006 Feb 23;49(4):1271-81.Design, synthesis, and biological evaluation of 3,4-diarylmaleimides as angiogenesis inhibitors. | ||||
| Ref 530491 | Eur J Med Chem. 2010 Jan;45(1):379-86. Epub 2009 Oct 13.Synthesis and cytotoxic activity of 2-methylimidazo[1,2-a]pyridine- and quinoline-substituted 2-aminopyrimidine derivatives. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
