Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T03573
|
||||
| Former ID |
TTDNC00464
|
||||
| Target Name |
CD32b
|
||||
| Gene Name |
FCGR2B
|
||||
| Synonyms |
CD32; CDw32; FcRIIb; Fcgamma RIIb; FcgammaRIIb; IgG Fc receptor IIb; Low affinity immunoglobulin gamma Fc region receptor IIb; FCGR2B
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Function |
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B- cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis.
|
||||
| UniProt ID | |||||
| Sequence |
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA LEEPDDQNRI |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| KEGG Pathway | Phagosome | ||||
| Osteoclast differentiation | |||||
| B cell receptor signaling pathway | |||||
| Fc gamma R-mediated phagocytosis | |||||
| Staphylococcus aureus infection | |||||
| Tuberculosis | |||||
| Measles | |||||
| NetPath Pathway | Leptin Signaling Pathway | ||||
| Pathway Interaction Database | Fc-epsilon receptor I signaling in mast cells | ||||
| BCR signaling pathway | |||||
| Reactome | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
| WikiPathways | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
| References | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
