Target General Infomation
Target ID
T13714
Former ID
TTDR00421
Target Name
Oxysterols receptor LXR-beta
Gene Name
NR1H2
Synonyms
LXRbeta; Liver X receptor beta; Nuclear orphan receptor LXR-beta; Nuclear receptor NER; Ubiquitously-expressed nuclear receptor; NR1H2
Target Type
Research
Disease Atherosclerosis [ICD9: 414.0, 440; ICD10: I70]
Function
Nuclear receptor. Binds preferentially to double- stranded oligonucleotide direct repeats having the consensus half- site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4). Regulates cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8; DLDLR and LRP8. Interplays functionally with RORA for the regulation of genes involved in liver metabolism (By similarity).
BioChemical Class
Nuclear hormone receptor
Target Validation
T13714
UniProt ID
Sequence
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Inhibitor 12,17-dehydroxyriccardin C Drug Info [529375]
12-dehydroxyriccardin C Drug Info [529375]
17-dehydroxyriccardin C Drug Info [529375]
2-Benzyl-3-phenyl-7-(trifluoromethyl)-2H-indazole Drug Info [529781]
2-benzyl-4,5,6,7-tetrachloroisoindoline-1,3-dione Drug Info [528834]
2-Propanol, Isopropanol Drug Info [551393]
4,17-dehydroxyriccardin C Drug Info [529375]
4-dehydroxyriccardin C Drug Info [529375]
Benzenesulfonyl Drug Info [551393]
GSK-9772 Drug Info [529702]
GW-3965 Drug Info [529781]
N-{4-[2-(3-Methoxyphenyl)ethyl]phenyl}phthalimide Drug Info [530220]
Riccardin C Drug Info [529375]
WAY-214950 Drug Info [529781]
WAY-252623 Drug Info [529781]
WAY-254011 Drug Info [530094]
Agonist 22R-hydroxycholesterol Drug Info [534255]
24(S), 25-epoxycholesterol Drug Info [532179]
24(S)-hydroxycholesterol Drug Info [534311]
27-hydroxycholesterol Drug Info [526122]
acetyl-podocarpic dimer Drug Info [526248]
AZ12260493 Drug Info [543893]
desmosterol Drug Info [528328]
L-783483 Drug Info [535486]
Antagonist GSK2033 Drug Info [530809]
SR9238 Drug Info [532155]
Pathways
Pathway Interaction Database RXR and RAR heterodimerization with other nuclear receptor
Reactome Nuclear Receptor transcription pathway
WikiPathways SREBP signalling
Nuclear Receptors
References
Ref 52612227-hydroxycholesterol is an endogenous ligand for liver X receptor in cholesterol-loaded cells. J Biol Chem. 2001 Oct 19;276(42):38378-87. Epub 2001 Aug 14.
Ref 526248A potent synthetic LXR agonist is more effective than cholesterol loading at inducing ABCA1 mRNA and stimulating cholesterol efflux. J Biol Chem. 2002 Mar 22;277(12):10021-7. Epub 2002 Jan 14.
Ref 528328Sterol intermediates from cholesterol biosynthetic pathway as liver X receptor ligands. J Biol Chem. 2006 Sep 22;281(38):27816-26. Epub 2006 Jul 20.
Ref 528834Bioorg Med Chem Lett. 2007 Jul 15;17(14):3957-61. Epub 2007 Apr 30.Liver X receptor antagonists with a phthalimide skeleton derived from thalidomide-related glucosidase inhibitors.
Ref 529375Bioorg Med Chem. 2008 Apr 15;16(8):4272-85. Epub 2008 Feb 29.Co-existence of alpha-glucosidase-inhibitory and liver X receptor-regulatory activities and their separation by structural development.
Ref 529702J Med Chem. 2008 Sep 25;51(18):5758-65.Structure-guided design of N-phenyl tertiary amines as transrepression-selective liver X receptor modulators with anti-inflammatory activity.
Ref 529781J Med Chem. 2008 Nov 27;51(22):7161-8.Indazole-based liver X receptor (LXR) modulators with maintained atherosclerotic lesion reduction activity but diminished stimulation of hepatic triglyceride synthesis.
Ref 530094Bioorg Med Chem. 2009 May 15;17(10):3519-27. Epub 2009 Apr 12.Discovery and SAR of cinnolines/quinolines as liver X receptor (LXR) agonists with binding selectivity for LXRbeta.
Ref 530220Bioorg Med Chem. 2009 Jul 15;17(14):5001-14. Epub 2009 Jun 2.Separation of alpha-glucosidase-inhibitory and liver X receptor-antagonistic activities of phenethylphenyl phthalimide analogs and generation of LXRalpha-selective antagonists.
Ref 530809Discovery of tertiary sulfonamides as potent liver X receptor antagonists. J Med Chem. 2010 Apr 22;53(8):3412-6.
Ref 532155A liver-selective LXR inverse agonist that suppresses hepatic steatosis. ACS Chem Biol. 2013 Mar 15;8(3):559-67.
Ref 532179Brain endogenous liver X receptor ligands selectively promote midbrain neurogenesis. Nat Chem Biol. 2013 Feb;9(2):126-33.
Ref 534255An oxysterol signalling pathway mediated by the nuclear receptor LXR alpha. Nature. 1996 Oct 24;383(6602):728-31.
Ref 534311Activation of the nuclear receptor LXR by oxysterols defines a new hormone response pathway. J Biol Chem. 1997 Feb 7;272(6):3137-40.
Ref 535486A novel liver X receptor agonist establishes species differences in the regulation of cholesterol 7alpha-hydroxylase (CYP7a). Endocrinology. 2002 Jul;143(7):2548-58.
Ref 543893(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 601).
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.