Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T19923
|
||||
| Former ID |
TTDR01405
|
||||
| Target Name |
mRNA of Bcl-x
|
||||
| Gene Name |
BCL2L1
|
||||
| Synonyms |
Apoptosis regulator BclX (mRNA); BCL2L1 (mRNA); Bcl2L1 (mRNA); Bcl2like protein 1 (mRNA); BCL2L1
|
||||
| Target Type |
Discontinued
|
||||
| Function |
Isoform Bcl-X(S) promotes apoptosis.
|
||||
| BioChemical Class |
Bcl-2 family
|
||||
| Target Validation |
T19923
|
||||
| UniProt ID | |||||
| Sequence |
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Ras signaling pathway | ||||
| NF-kappa B signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| Apoptosis | |||||
| Jak-STAT signaling pathway | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| Toxoplasmosis | |||||
| HTLV-I infection | |||||
| Pathways in cancer | |||||
| Transcriptional misregulation in cancer | |||||
| Pancreatic cancer | |||||
| Chronic myeloid leukemia | |||||
| Small cell lung cancer | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| TGF_beta_Receptor Signaling Pathway | |||||
| Notch Signaling Pathway | |||||
| PANTHER Pathway | Apoptosis signaling pathway | ||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | IL2 signaling events mediated by PI3K | ||||
| IL3-mediated signaling events | |||||
| Caspase Cascade in Apoptosis | |||||
| EPO signaling pathway | |||||
| IL2 signaling events mediated by STAT5 | |||||
| Reactome | BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members | ||||
| The NLRP1 inflammasome | |||||
| WikiPathways | IL-6 signaling pathway | ||||
| IL-3 Signaling Pathway | |||||
| Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways | |||||
| Apoptosis | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| TNF alpha Signaling Pathway | |||||
| IL-7 Signaling Pathway | |||||
| Leptin signaling pathway | |||||
| Intrinsic Pathway for Apoptosis | |||||
| Apoptosis Modulation and Signaling | |||||
| References | |||||
| Ref 526790 | J Med Chem. 2003 Sep 25;46(20):4259-64.Discovery, characterization, and structure-activity relationships studies of proapoptotic polyphenols targeting B-cell lymphocyte/leukemia-2 proteins. | ||||
| Ref 528469 | J Med Chem. 2006 Oct 19;49(21):6139-42.Structure-based design of potent small-molecule inhibitors of anti-apoptotic Bcl-2 proteins. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
