Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T23347
|
||||
| Former ID |
TTDC00234
|
||||
| Target Name |
Interleukin-1 receptor, type II
|
||||
| Gene Name |
IL1R2
|
||||
| Synonyms |
Antigen CDw121b; IL-1R-2; IL-1R-beta; Interleukin 1 receptor type II; IL1R2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Arthritis [ICD9: 710-719; ICD10: M00-M25] | ||||
| Immune disorder [ICD10: D80-D89] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Function |
Non-signaling receptor for IL1A, IL1B and IL1RN. Reduces IL1B activities. Serves as a decoy receptor by competetive binding to IL1B and preventing its binding to IL1R1. Also modulates cellular response through non-signaling association with IL1RAP after binding to IL1B. IL1R2 (membrane and secreted forms) preferentially binds IL1B and poorly IL1A and IL1RN. The secreted IL1R2 recruits secreted IL1RAP with high affinity; this complexformation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors.
|
||||
| BioChemical Class |
Interleukin receptor family
|
||||
| Target Validation |
T23347
|
||||
| UniProt ID | |||||
| Sequence |
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS IELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLA FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Cytokine-cytokine receptor interaction | |||||
| Hematopoietic cell lineage | |||||
| Amoebiasis | |||||
| HTLV-I infection | |||||
| Transcriptional misregulation in cancer | |||||
| NetPath Pathway | IL1 Signaling Pathway | ||||
| TNFalpha Signaling Pathway | |||||
| Pathway Interaction Database | IL1-mediated signaling events | ||||
| Reactome | Interleukin-1 signaling | ||||
| WikiPathways | MAPK Signaling Pathway | ||||
| Interleukin-1 signaling | |||||
| Apoptosis Modulation and Signaling | |||||
| References | |||||
| Ref 522135 | ClinicalTrials.gov (NCT00539760) A Phase I Rheumatoid Arthritis Study in Healthy Volunteers. U.S. National Institutes of Health. | ||||
| Ref 534263 | Effect of FR133605, a novel cytokine suppressive agent, on bone and cartilage destruction in adjuvant arthritic rats. J Rheumatol. 1996 Oct;23(10):1778-83. | ||||
| Ref 534068 | SDZ MRL 953, a lipid A analog as selective cytokine inducer. Prog Clin Biol Res. 1995;392:549-65. | ||||
| Ref 534263 | Effect of FR133605, a novel cytokine suppressive agent, on bone and cartilage destruction in adjuvant arthritic rats. J Rheumatol. 1996 Oct;23(10):1778-83. | ||||
| Ref 536524 | Inflammatory molecules: a target for treatment of systemic autoimmune diseases. Autoimmun Rev. 2007 Nov;7(1):1-7. Epub 2007 Mar 26. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
