Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T24982
|
||||
| Former ID |
TTDNC00442
|
||||
| Target Name |
Ileal bile acid transfer
|
||||
| Gene Name |
SLC10A2
|
||||
| Synonyms |
ASBT; Apical sodiumdependent bile acid transporter; IBAT; ISBT; Ileal Na(+)/bile acid cotransporter; Ileal sodium/bile acid cotransporter; Ileal sodiumdependent bile acid transporter; Na(+)dependent ileal bile acid transporter; Sodium/taurocholate cotransporting polypeptide, ileal; Solute carrier family 10 member 2; SLC10A2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78] | ||||
| Lipid metabolism disorder [ICD10: E75-E78] | |||||
| Primary biliary cirrhosis [ICD9: 571.6; ICD10: K74.3] | |||||
| Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. Plays a key role in cholesterol metabolism.
|
||||
| BioChemical Class |
Bile acid:na(+) symporter
|
||||
| UniProt ID | |||||
| Sequence |
MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | A-3309 | Drug Info | Phase 3 | Lipid metabolism disorder | [524353] |
| 264W94 | Drug Info | Phase 2 | Hyperlipidaemia | [531629], [541657] | |
| GSK2330672 | Drug Info | Phase 2 | Type 2 diabetes | [532355] | |
| LUM001 | Drug Info | Phase 2 | Primary biliary cirrhosis | [525031] | |
| S-8921 | Drug Info | Phase 2 | Hyperlipidaemia | [534690] | |
| 1614235 + 2330672 | Drug Info | Phase 1 | Type 2 diabetes | [549464] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Bile secretion | ||||
| Reactome | Recycling of bile acids and salts | ||||
| WikiPathways | Bile acid and bile salt metabolism | ||||
| References | |||||
| Ref 524353 | ClinicalTrials.gov (NCT01895543) Safety and Tolerability Extension Trial for Patients With Chronic Idiopathic Constipation. U.S. National Institutes of Health. | ||||
| Ref 525031 | ClinicalTrials.gov (NCT02321306) An Open-label Study to Evaluate the Long-term Safety and Tolerability of LUM001 in Patients With Primary Biliary Cirrhosis. U.S. National Institutes of Health. | ||||
| Ref 531629 | Inhibition of apical sodium-dependent bile acid transporter as a novel treatment for diabetes. Am J Physiol Endocrinol Metab. 2012 Jan 1;302(1):E68-76. | ||||
| Ref 532355 | Discovery of a highly potent, nonabsorbable apical sodium-dependent bile acid transporter inhibitor (GSK2330672) for treatment of type 2 diabetes. J Med Chem. 2013 Jun 27;56(12):5094-114. | ||||
| Ref 534690 | Inhibition of ileal Na+/bile acid cotransporter by S-8921 reduces serum cholesterol and prevents atherosclerosis in rabbits. Arterioscler Thromb Vasc Biol. 1998 Aug;18(8):1304-11. | ||||
| Ref 531629 | Inhibition of apical sodium-dependent bile acid transporter as a novel treatment for diabetes. Am J Physiol Endocrinol Metab. 2012 Jan 1;302(1):E68-76. | ||||
| Ref 532143 | Elobixibat for the treatment of constipation. Expert Opin Investig Drugs. 2013 Feb;22(2):277-84. | ||||
| Ref 532355 | Discovery of a highly potent, nonabsorbable apical sodium-dependent bile acid transporter inhibitor (GSK2330672) for treatment of type 2 diabetes. J Med Chem. 2013 Jun 27;56(12):5094-114. | ||||
| Ref 534551 | Expression and transport properties of the human ileal and renal sodium-dependent bile acid transporter. Am J Physiol. 1998 Jan;274(1 Pt 1):G157-69. | ||||
| Ref 534690 | Inhibition of ileal Na+/bile acid cotransporter by S-8921 reduces serum cholesterol and prevents atherosclerosis in rabbits. Arterioscler Thromb Vasc Biol. 1998 Aug;18(8):1304-11. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
