Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T25464
|
||||
| Former ID |
TTDS00363
|
||||
| Target Name |
Calcineurin
|
||||
| Gene Name |
PPP3CA
|
||||
| Synonyms |
Serine/threonine protein phosphatase; PPP3CA
|
||||
| Target Type |
Successful
|
||||
| Disease | Atopic dermatitis [ICD9: 691.8, 692.9; ICD10: L00-L99] | ||||
| Kidney diseases; Heart transplantation [ICD9: 996; ICD10: T86] | |||||
| Organ transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86] | |||||
| Ocular allergy [ICD9: 360-379; ICD10: H00-H59] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Xerophthalmia [ICD10: E50.6-E50.7] | |||||
| Function |
Calcium-dependent, calmodulin-stimulated protein phosphatase. Many of the substrates contain a PxIxIT motif. This subunit may have a role in the calmodulin activation of calcineurin. Dephosphorylates DNM1L, HSPB1 and SSH1.
|
||||
| BioChemical Class |
Phosphoric monoester hydrolases
|
||||
| Target Validation |
T25464
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.1.3.16
|
||||
| Sequence |
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN ERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Cyclosporine | Drug Info | Approved | Psoriasis | [536395] |
| Pimecrolimus | Drug Info | Approved | Atopic dermatitis | [536054], [541863] | |
| Tacrolimus | Drug Info | Approved | Organ transplant rejection | [537129], [541864] | |
| Tacrolimus | Drug Info | Phase 3 | Ocular allergy | [537129], [541864] | |
| Voclosporin | Drug Info | Phase 3 | Psoriasis | [537117] | |
| Voclosporin | Drug Info | Phase 2 | Kidney diseases; Heart transplantation | [537117] | |
| Cyclosporine | Drug Info | Investigative | Xerophthalmia | [536395] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Calcium signaling pathway | |||||
| cGMP-PKG signaling pathway | |||||
| Oocyte meiosis | |||||
| Apoptosis | |||||
| Wnt signaling pathway | |||||
| Axon guidance | |||||
| VEGF signaling pathway | |||||
| Osteoclast differentiation | |||||
| Natural killer cell mediated cytotoxicity | |||||
| T cell receptor signaling pathway | |||||
| B cell receptor signaling pathway | |||||
| Long-term potentiation | |||||
| Glutamatergic synapse | |||||
| Dopaminergic synapse | |||||
| Oxytocin signaling pathway | |||||
| Glucagon signaling pathway | |||||
| Alzheimer' | |||||
| s disease | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| Amphetamine addiction | |||||
| Tuberculosis | |||||
| HTLV-I infection | |||||
| Reactome | DARPP-32 events | ||||
| FCERI mediated Ca+2 mobilization | |||||
| Ca2+ pathway | |||||
| WikiPathways | Mitochondrial Gene Expression | ||||
| MAPK Signaling Pathway | |||||
| G Protein Signaling Pathways | |||||
| Cardiac Hypertrophic Response | |||||
| Fc epsilon receptor (FCERI) signaling | |||||
| Signaling by the B Cell Receptor (BCR) | |||||
| T-Cell Receptor and Co-stimulatory Signaling | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| Spinal Cord Injury | |||||
| Alzheimers Disease | |||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| Opioid Signalling | |||||
| MicroRNAs in cardiomyocyte hypertrophy | |||||
| Physiological and Pathological Hypertrophy of the Heart | |||||
| References | |||||
| Ref 536054 | Emerging drugs for moderate-to-severe psoriasis. Expert Opin Emerg Drugs. 2005 Feb;10(1):35-52. | ||||
| Ref 536395 | Cyclosporine and tacrolimus for the treatment of rheumatoid arthritis. Curr Opin Rheumatol. 2007 May;19(3):238-45. | ||||
| Ref 537129 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | ||||
| Ref 534961 | Synergistic antifungal activities of bafilomycin A(1), fluconazole, and the pneumocandin MK-0991/caspofungin acetate (L-743,873) with calcineurin inhibitors FK506 and L-685,818 against Cryptococcus neoformans. Antimicrob Agents Chemother. 2000 Mar;44(3):739-46. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
