Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T26203
|
||||
| Former ID |
TTDI01933
|
||||
| Target Name |
ICAM-1
|
||||
| Gene Name |
ICAM1
|
||||
| Synonyms |
CD54; Intercellular adhesion molecule 1; Major group rhinovirus receptor; ICAM1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Allergic conjunctivitis [ICD9: 204.0, 372.0, 372.14, 995.3; ICD10: C91.0, H10, H10.45, T78.4] | ||||
| Hormone refractory prostate cancer [ICD9: 140-229, 185; ICD10: C61] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
| Multiple myeloma [ICD9: 203; ICD10: C90] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans- endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation.In case of rhinovirus infection acts as a cellular receptor for the virus.
|
||||
| BioChemical Class |
Immunoglobulin
|
||||
| UniProt ID | |||||
| Sequence |
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | SAR-1118 | Drug Info | Phase 3 | Allergic conjunctivitis | [523596], [542538] |
| APC-8015F | Drug Info | Phase 2 | Hormone refractory prostate cancer | [522591] | |
| BI-505 | Drug Info | Phase 1 | Multiple myeloma | [532319] | |
| A-252444.0 | Drug Info | Terminated | Inflammatory disease | [547055] | |
| GI-270384X | Drug Info | Terminated | Inflammatory bowel disease | [529903] | |
| MOR-102 | Drug Info | Terminated | Psoriasis | [547549] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | NF-kappa B signaling pathway | ||||
| Cell adhesion molecules (CAMs) | |||||
| Natural killer cell mediated cytotoxicity | |||||
| TNF signaling pathway | |||||
| Leukocyte transendothelial migration | |||||
| African trypanosomiasis | |||||
| Malaria | |||||
| Staphylococcus aureus infection | |||||
| Influenza A | |||||
| HTLV-I infection | |||||
| Epstein-Barr virus infection | |||||
| Rheumatoid arthritis | |||||
| Viral myocarditis | |||||
| NetPath Pathway | IL5 Signaling Pathway | ||||
| IL1 Signaling Pathway | |||||
| TSH Signaling Pathway | |||||
| IL6 Signaling Pathway | |||||
| IL2 Signaling Pathway | |||||
| ID Signaling Pathway | |||||
| TWEAK Signaling Pathway | |||||
| RANKL Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| Pathway Interaction Database | Thromboxane A2 receptor signaling | ||||
| Glucocorticoid receptor regulatory network | |||||
| amb2 Integrin signaling | |||||
| Beta2 integrin cell surface interactions | |||||
| Reactome | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
| Integrin cell surface interactions | |||||
| Interferon gamma signaling | |||||
| WikiPathways | Type II interferon signaling (IFNG) | ||||
| IL1 and megakaryotyces in obesity | |||||
| Human Complement System | |||||
| Spinal Cord Injury | |||||
| Interleukin-11 Signaling Pathway | |||||
| RANKL/RANK Signaling Pathway | |||||
| Integrin cell surface interactions | |||||
| Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| Folate Metabolism | |||||
| Vitamin B12 Metabolism | |||||
| Selenium Micronutrient Network | |||||
| References | |||||
| Ref 522591 | ClinicalTrials.gov (NCT00849290) Immunotherapy For Men With Objective Disease Progression On Protocol D9902 Part B (NCT00065442). U.S. National Institutes of Health. | ||||
| Ref 523596 | ClinicalTrials.gov (NCT01421498) Safety and Efficacy Study of SAR 1118 to Treat Dry Eye. U.S. National Institutes of Health. | ||||
| Ref 529903 | Inhibition of endothelial cell adhesion molecule expression improves colonic hyperalgaesia. Neurogastroenterol Motil. 2009 Feb;21(2):189-96. | ||||
| Ref 532319 | A human ICAM-1 antibody isolated by a function-first approach has potent macrophage-dependent antimyeloma activity in vivo. Cancer Cell. 2013 Apr 15;23(4):502-15. | ||||
| Ref 542538 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7533). | ||||
| Ref 527755 | Efficacy of the fully human monoclonal antibody MOR102 (#5) against intercellular adhesion molecule 1 in the psoriasis-severe combined immunodeficient mouse model. Br J Dermatol. 2005 Oct;153(4):758-66. | ||||
| Ref 529903 | Inhibition of endothelial cell adhesion molecule expression improves colonic hyperalgaesia. Neurogastroenterol Motil. 2009 Feb;21(2):189-96. | ||||
| Ref 532319 | A human ICAM-1 antibody isolated by a function-first approach has potent macrophage-dependent antimyeloma activity in vivo. Cancer Cell. 2013 Apr 15;23(4):502-15. | ||||
| Ref 532815 | Discovery and Development of Potent LFA-1/ICAM-1 Antagonist SAR 1118 as an Ophthalmic Solution for Treating Dry Eye. ACS Med Chem Lett. 2012 Jan 31;3(3):203-6. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
