Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T30040
|
||||
| Former ID |
TTDR00926
|
||||
| Target Name |
Vascular endothelial growth factor B
|
||||
| Gene Name |
VEGFB
|
||||
| Synonyms |
VEGF-B; VEGF-related factor; VRF; VEGFB
|
||||
| Target Type |
Successful
|
||||
| Disease | Metastatic colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | ||||
| Function |
Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
|
||||
| BioChemical Class |
PDGF VEGF growth factor
|
||||
| UniProt ID | |||||
| Sequence |
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP STTSALTPGPAAAAADAAASSVAKGGA |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Ras signaling pathway | ||||
| Rap1 signaling pathway | |||||
| Cytokine-cytokine receptor interaction | |||||
| PI3K-Akt signaling pathway | |||||
| Focal adhesion | |||||
| Pathways in cancer | |||||
| NetPath Pathway | TSH Signaling Pathway | ||||
| Pathway Interaction Database | VEGFR1 specific signals | ||||
| Reactome | Platelet degranulation | ||||
| VEGF ligand-receptor interactions | |||||
| VEGF binds to VEGFR leading to receptor dimerization | |||||
| WikiPathways | Focal Adhesion | ||||
| Signaling by VEGF | |||||
| Heart Development | |||||
| References | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
