Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T37693
|
||||
| Former ID |
TTDC00314
|
||||
| Target Name |
Cannabinoid receptor 2
|
||||
| Gene Name |
CNR2
|
||||
| Synonyms |
CB-2; CB2; CX5; Cannabinoid CB2 receptor; CNR2
|
||||
| Target Type |
Successful
|
||||
| Disease | Atopic dermatitis [ICD9: 691.8, 692.9; ICD10: L00-L99] | ||||
| Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63] | |||||
| Chemotherapy-induced nausea [ICD9: 787, 787.0; ICD10: R11] | |||||
| Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
| Ischemia [ICD9: 459.89; ICD10: I99.8] | |||||
| Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
| Immune disorder [ICD10: D80-D89] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Lipid metabolism disorder [ICD10: E75-E78] | |||||
| Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
| Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
| Osteoporosis [ICD9: 733.0, V07.4; ICD10: M80-M81, Z79.890] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Function |
Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T37693
|
||||
| UniProt ID | |||||
| Sequence |
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | NABILONE | Drug Info | Approved | Insomnia | [551871] |
| Dronabinol oral solution | Drug Info | Phase 2/3 | Chemotherapy-induced nausea | [551036] | |
| 842166X | Drug Info | Phase 2 | Pain | [521980] | |
| GW-42004 | Drug Info | Phase 2 | Lipid metabolism disorder | [549419] | |
| KHK-6188 | Drug Info | Phase 2 | Neuropathic pain | [523813] | |
| LY-2828360 | Drug Info | Phase 2 | Pain | [523404] | |
| S-777469 | Drug Info | Phase 2 | Atopic dermatitis | [537075] | |
| Tedalinab | Drug Info | Phase 1 | Pain | [548356] | |
| Research programme: small molecule therapeutics, Boehringer Ingelheim | Drug Info | Preclinical | Pain | [548042] | |
| KN-38-7271 | Drug Info | Discontinued in Phase 2 | Ischemia | [547265] | |
| PRS-211375 iv | Drug Info | Discontinued in Phase 2 | Pain | [542484], [547996] | |
| TAK-937 | Drug Info | Discontinued in Phase 1 | Cerebrovascular ischaemia | [548963] | |
| AM-577 | Drug Info | Terminated | Pain | [547668] | |
| PRS-639058 | Drug Info | Terminated | Neuropathic pain | [547996] | |
| PXS-2076 | Drug Info | Terminated | Rheumatoid arthritis | [548079] | |
| WIN-55212-2 | Drug Info | Terminated | Discovery agent | [542353], [545702] | |
| Inhibitor | (1R,2R)-N-Arachidonoylcyclopropanolamide | Drug Info | [530070] | ||
| (1R,2R)-N-Oleoylcyclopropanolamide | Drug Info | [530070] | |||
| (1R,2S)-N-Arachidonoylcyclopropanolamide | Drug Info | [530070] | |||
| (1R,2S)-N-Oleoylcyclopropanolamide | Drug Info | [530070] | |||
| (1S,2R)-N-Oleoylcyclopropanolamide | Drug Info | [530070] | |||
| (1S,2S)-N-Arachidonoylcyclopropanolamide | Drug Info | [530070] | |||
| (1S,2S)-N-Oleoylcyclopropanolamide | Drug Info | [530070] | |||
| (2R)-N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| (2R)-N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| (2S)-N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| (4-benzhydrylpiperazin-1-yl)(cyclohexyl)methanone | Drug Info | [530617] | |||
| (E)-N-(3,5-dimethoxyphenethyl)undec-2-enamide | Drug Info | [527788] | |||
| (E)-N-(4-methoxyphenethyl)undec-2-enamide | Drug Info | [527788] | |||
| (E)-N-(4-methoxyphenyl)undec-2-enamide | Drug Info | [527788] | |||
| 1,4-dihydroindeno[1,2-c]-pyrazole | Drug Info | [527858] | |||
| 2'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol | Drug Info | [528844] | |||
| 2-(2-Methoxybenzyl)-3H-benzo[f]chromen-3-one | Drug Info | [530009] | |||
| 3'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol | Drug Info | [528844] | |||
| 3,4-diarylpyrazoline derivative | Drug Info | [527721] | |||
| 3-benzoyl-1-pentyl-1,4-dihydroquinolin-4-one | Drug Info | [529079] | |||
| 3-Benzyl-5-isopropyl-8-methylchromen-2-one | Drug Info | [530009] | |||
| 4'-(1,1-dimethyl-heptyl)-3,5-dimethyl-biphenyl | Drug Info | [528844] | |||
| 4'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol | Drug Info | [528844] | |||
| 4-(1,1-dimethyl-heptyl)-2'-methoxy-biphenyl-2-ol | Drug Info | [528844] | |||
| 4-(1,1-dimethyl-heptyl)-3'-methoxy-biphenyl-2-ol | Drug Info | [528844] | |||
| 4-benzhydryl-N-butylpiperazine-1-carboxamide | Drug Info | [530617] | |||
| 4-benzhydryl-N-cyclohexylpiperazine-1-carboxamide | Drug Info | [530617] | |||
| 5-(1,1-dimethyl-heptyl)-2-pyridin-3-yl-phenol | Drug Info | [528844] | |||
| 5-Biphenyl-4-ylmethyl-1-isobutyl-1H-tetrazole | Drug Info | [529434] | |||
| 5-Biphenyl-4-ylmethyl-2-isobutyl-2H-tetrazole | Drug Info | [529434] | |||
| 5-Methoxy-3-(2-methoxybenzyl)-2H-chromen-2-one | Drug Info | [530009] | |||
| 6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| 6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-((R)-1-HYDROXYETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| 6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(1-HYDROXY-2-METHYLPROPAN-2-YL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| 6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(HYDROXYMETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| A-796260 | Drug Info | [530525] | |||
| AM-1241 | Drug Info | [530525] | |||
| AM-1710 | Drug Info | [529170] | |||
| AM-1714 | Drug Info | [529170] | |||
| AM-1715 | Drug Info | [529170] | |||
| AM-281 | Drug Info | [530009] | |||
| AM-404 | Drug Info | [529838] | |||
| AM-411 | Drug Info | [531004] | |||
| AM-4768 | Drug Info | [529170] | |||
| AM-630 | Drug Info | [529106] | |||
| Cis-N-oleoylcyclopropanolamide | Drug Info | [530070] | |||
| CP-55940 | Drug Info | [528562] | |||
| DELTA 8-TETRAHYDROCANNOBINOL | Drug Info | [529727] | |||
| Dodeca-2E,4E-dienoic acid isobutylamide | Drug Info | [528831] | |||
| GNF-PF-5188 | Drug Info | [529920] | |||
| JWH-120 | Drug Info | [529920] | |||
| JWH-133 | Drug Info | [528452] | |||
| JWH-145 | Drug Info | [528355] | |||
| JWH-146 | Drug Info | [528355] | |||
| JWH-147 | Drug Info | [528355] | |||
| JWH-150 | Drug Info | [528355] | |||
| JWH-151 | Drug Info | [529920] | |||
| JWH-156 | Drug Info | [528355] | |||
| JWH-167 | Drug Info | [527630] | |||
| JWH-201 | Drug Info | [527630] | |||
| JWH-202 | Drug Info | [527630] | |||
| JWH-203 | Drug Info | [527630] | |||
| JWH-204 | Drug Info | [527630] | |||
| JWH-205 | Drug Info | [527630] | |||
| JWH-206 | Drug Info | [527630] | |||
| JWH-207 | Drug Info | [527630] | |||
| JWH-208 | Drug Info | [527630] | |||
| JWH-209 | Drug Info | [527630] | |||
| JWH-229 | Drug Info | [529920] | |||
| JWH-237 | Drug Info | [527630] | |||
| JWH-243 | Drug Info | [528355] | |||
| JWH-244 | Drug Info | [528355] | |||
| JWH-245 | Drug Info | [528355] | |||
| JWH-246 | Drug Info | [528355] | |||
| JWH-248 | Drug Info | [527630] | |||
| JWH-249 | Drug Info | [527630] | |||
| JWH-250 | Drug Info | [527630] | |||
| JWH-251 | Drug Info | [527630] | |||
| JWH-252 | Drug Info | [527630] | |||
| JWH-253 | Drug Info | [527630] | |||
| JWH-268 | Drug Info | [529920] | |||
| JWH-292 | Drug Info | [528355] | |||
| JWH-293 | Drug Info | [528355] | |||
| JWH-294 | Drug Info | [529084] | |||
| JWH-295 | Drug Info | [529084] | |||
| JWH-296 | Drug Info | [529084] | |||
| JWH-297 | Drug Info | [529084] | |||
| JWH-302 | Drug Info | [527630] | |||
| JWH-303 | Drug Info | [527630] | |||
| JWH-305 | Drug Info | [527630] | |||
| JWH-306 | Drug Info | [527630] | |||
| JWH-307 | Drug Info | [528355] | |||
| JWH-308 | Drug Info | [528355] | |||
| JWH-309 | Drug Info | [528355] | |||
| JWH-311 | Drug Info | [527630] | |||
| JWH-312 | Drug Info | [527630] | |||
| JWH-313 | Drug Info | [527630] | |||
| JWH-314 | Drug Info | [527630] | |||
| JWH-315 | Drug Info | [527630] | |||
| JWH-323 | Drug Info | [529084] | |||
| JWH-324 | Drug Info | [531027] | |||
| JWH-325 | Drug Info | [529084] | |||
| JWH-337 | Drug Info | [529084] | |||
| JWH-342 | Drug Info | [529084] | |||
| JWH-343 | Drug Info | [529084] | |||
| JWH-344 | Drug Info | [529084] | |||
| JWH-345 | Drug Info | [529084] | |||
| JWH-346 | Drug Info | [528355] | |||
| JWH-347 | Drug Info | [528355] | |||
| JWH-348 | Drug Info | [528355] | |||
| JWH-363 | Drug Info | [528355] | |||
| JWH-364 | Drug Info | [528355] | |||
| JWH-365 | Drug Info | [528355] | |||
| JWH-366 | Drug Info | [528355] | |||
| JWH-367 | Drug Info | [528355] | |||
| JWH-368 | Drug Info | [528355] | |||
| JWH-369 | Drug Info | [528355] | |||
| JWH-370 | Drug Info | [528355] | |||
| JWH-371 | Drug Info | [528355] | |||
| JWH-372 | Drug Info | [528355] | |||
| JWH-373 | Drug Info | [528355] | |||
| JWH-385 | Drug Info | [529084] | |||
| JWH-392 | Drug Info | [529084] | |||
| JWH-401 | Drug Info | [529084] | |||
| JWH-402 | Drug Info | [529084] | |||
| JWH-403 | Drug Info | [529084] | |||
| JWH-404 | Drug Info | [529084] | |||
| JWH-405 | Drug Info | [529084] | |||
| JWH-406 | Drug Info | [529084] | |||
| JWH-407 | Drug Info | [529084] | |||
| JWH-440 | Drug Info | [531027] | |||
| JWH-441 | Drug Info | [531027] | |||
| JWH-442 | Drug Info | [531027] | |||
| KM-233 | Drug Info | [529515] | |||
| KM-233-M | Drug Info | [529515] | |||
| N-(1H-indazol-5-yl)icosa-5,8,11,14-tetraenamide | Drug Info | [529838] | |||
| N-(2-chloroethyl)icosa-5,8,11,14-tetraenamide | Drug Info | [529106] | |||
| N-(3,3-Diphenyl)propyl-2,2-diphenylacetamide | Drug Info | [529563] | |||
| N-(3-Phenyl)propyl-2-(4-bromophenylacetamide) | Drug Info | [529563] | |||
| N-(4-hydroxybenzyl)icosa-5,8,11,14-tetraenamide | Drug Info | [529838] | |||
| N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYACETAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXY-2,2-DIMETHYLPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXY-2-METHYLPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| N-(7-(2-CHLOROPHENYL)-6-(4-CHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYACETAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
| N-arachidonoyl-N-(2-hydroxyethyl)hydroxylamine | Drug Info | [528112] | |||
| N-arachidonoyl-O-(2-hydroxyethyl)hydroxylamine | Drug Info | [528112] | |||
| N-benzyl-4-bromo-3-(morpholinosulfonyl)benzamide | Drug Info | [529872] | |||
| N-oleoyl-N-(2-hydroxyethyl)hydroxylamine | Drug Info | [528112] | |||
| N-oleoyl-O-(2-hydroxyethyl)hydroxylamine | Drug Info | [528112] | |||
| N-[6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-YL]-4,4,4-TRIFLUORO-3-HYDROXYBUTANAMIDE (DIASTEREOMERIC MIX) | Drug Info | [530871] | |||
| N1-(4-bromophenyl)-N2,N2-dipentylphthalamide | Drug Info | [529920] | |||
| NABILONE | Drug Info | [531196] | |||
| NAPHTHYRIDINONE | Drug Info | [527839] | |||
| O-arachidonoyl-N-(2-hydroxyethyl)hydroxylamine | Drug Info | [528112] | |||
| O-oleoyl-N-(2-hydroxyethyl)hydroxylamine | Drug Info | [528112] | |||
| PRAVADOLINE | Drug Info | [551296] | |||
| Rac-cis-N-arachidonoylcyclopropanolamide | Drug Info | [530070] | |||
| Rac-trans-N-oleoylcyclopropanolamide | Drug Info | [530070] | |||
| SCH-225336 | Drug Info | [530693] | |||
| SCH-356036 | Drug Info | [530597] | |||
| VER-156084 | Drug Info | [530200] | |||
| VER-156085 | Drug Info | [530200] | |||
| WIN-55212-2 | Drug Info | [528907] | |||
| Agonist | 842166X | Drug Info | [532597] | ||
| AM-577 | Drug Info | [547669] | |||
| AR-XYZ | Drug Info | [543878] | |||
| JWH-015 | Drug Info | [536731] | |||
| JWH-051 | Drug Info | [543878] | |||
| KHK-6188 | Drug Info | [551579] | |||
| L-759,633 | Drug Info | [543878] | |||
| L-759,656 | Drug Info | [543878] | |||
| LY-2828360 | Drug Info | [551579] | |||
| MDA-19 | Drug Info | [543878] | |||
| Palmitoylethanolamide | Drug Info | [536731] | |||
| PRS-211375 iv | Drug Info | [544411] | |||
| PRS-639058 | Drug Info | [544486] | |||
| PXS-2076 | Drug Info | [543878] | |||
| Research programme: small molecule therapeutics, Boehringer Ingelheim | Drug Info | [543878] | |||
| RQ-00202730 | Drug Info | [543878] | |||
| S-777469 | Drug Info | [537075] | |||
| Sch-036 | Drug Info | [543878] | |||
| Tedalinab | Drug Info | [551201] | |||
| [3H]CP55940 | Drug Info | [534133] | |||
| [3H]HU-243 | Drug Info | [533602] | |||
| [3H]WIN55212-2 | Drug Info | [533680] | |||
| Modulator | Delta-9-tetrahydrocannabinol prodrugs | Drug Info | [543878] | ||
| Dronabinol oral solution | Drug Info | [1572591] | |||
| GW-42004 | Drug Info | ||||
| KN-38-7271 | Drug Info | ||||
| TAK-937 | Drug Info | [531715] | |||
| Activator | HU-433 | Drug Info | [543878] | ||
| Antagonist | SR144528 | Drug Info | [535198] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| References | |||||
| Ref 521980 | ClinicalTrials.gov (NCT00444769) Dental Pain 3rd Molar Tooth Extraction GW842166. U.S. National Institutes of Health. | ||||
| Ref 523404 | ClinicalTrials.gov (NCT01319929) A Study of LY2828360 in Patients With Osteoarthritic Knee Pain. U.S. National Institutes of Health. | ||||
| Ref 523813 | ClinicalTrials.gov (NCT01544296) A Comparative Study of KHK6188. U.S. National Institutes of Health. | ||||
| Ref 542353 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 733). | ||||
| Ref 542484 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 746). | ||||
| Ref 545702 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004262) | ||||
| Ref 547265 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014615) | ||||
| Ref 547668 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018288) | ||||
| Ref 547996 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021026) | ||||
| Ref 548042 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021465) | ||||
| Ref 548079 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021746) | ||||
| Ref 548356 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024918) | ||||
| Ref 548963 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030875) | ||||
| Ref 527630 | Bioorg Med Chem Lett. 2005 Sep 15;15(18):4110-3.1-Pentyl-3-phenylacetylindoles, a new class of cannabimimetic indoles. | ||||
| Ref 527721 | Bioorg Med Chem Lett. 2005 Nov 1;15(21):4794-8.Novel 3,4-diarylpyrazolines as potent cannabinoid CB1 receptor antagonists with lower lipophilicity. | ||||
| Ref 527788 | Bioorg Med Chem Lett. 2006 Jan 1;16(1):138-41. Epub 2005 Oct 6.New metabolically stable fatty acid amide ligands of cannabinoid receptors: Synthesis and receptor affinity studies. | ||||
| Ref 527839 | Bioorg Med Chem Lett. 2006 Feb;16(3):681-5. Epub 2005 Nov 2.Synthesis of functionalized 1,8-naphthyridinones and their evaluation as novel, orally active CB1 receptor inverse agonists. | ||||
| Ref 527858 | J Med Chem. 2005 Nov 17;48(23):7351-62.Tricyclic pyrazoles. 3. Synthesis, biological evaluation, and molecular modeling of analogues of the cannabinoid antagonist 8-chloro-1-(2',4'-dichlorophenyl)-N-piperidin-1-yl-1,4,5,6-tetrahydrobenzo[6,7]cyclohepta[1,2-c]pyrazole-3-carboxamide. | ||||
| Ref 528112 | J Med Chem. 2006 Apr 6;49(7):2333-8.Oxyhomologues of anandamide and related endolipids: chemoselective synthesis and biological activity. | ||||
| Ref 528355 | Bioorg Med Chem Lett. 2006 Oct 15;16(20):5432-5. Epub 2006 Aug 4.1-Alkyl-2-aryl-4-(1-naphthoyl)pyrroles: new high affinity ligands for the cannabinoid CB1 and CB2 receptors. | ||||
| Ref 528452 | J Med Chem. 2006 Oct 5;49(20):5947-57.Design, synthesis, and biological evaluation of new 1,8-naphthyridin-4(1H)-on-3-carboxamide and quinolin-4(1H)-on-3-carboxamide derivatives as CB2 selective agonists. | ||||
| Ref 528562 | J Med Chem. 2006 Dec 14;49(25):7502-12.Tricyclic pyrazoles. 4. Synthesis and biological evaluation of analogues of the robust and selective CB2 cannabinoid ligand 1-(2',4'-dichlorophenyl)-6-methyl-N-piperidin-1-yl-1,4-dihydroindeno[1,2-c]pyrazole-3-carboxamide. | ||||
| Ref 528831 | J Nat Prod. 2007 Jun;70(6):1010-5. Epub 2007 May 11.Self-assembling cannabinomimetics: supramolecular structures of N-alkyl amides. | ||||
| Ref 528844 | Bioorg Med Chem Lett. 2007 Jul 1;17(13):3652-6. Epub 2007 Apr 25.Biaryl cannabinoid mimetics--synthesis and structure-activity relationship. | ||||
| Ref 528907 | Eur J Med Chem. 2008 Mar;43(3):513-39. Epub 2007 May 6.Synthesis and cannabinoid activity of 1-substituted-indole-3-oxadiazole derivatives: novel agonists for the CB1 receptor. | ||||
| Ref 529079 | J Med Chem. 2007 Nov 1;50(22):5471-84. Epub 2007 Oct 4.Pharmacomodulations around the 4-oxo-1,4-dihydroquinoline-3-carboxamides, a class of potent CB2-selective cannabinoid receptor ligands: consequences in receptor affinity and functionality. | ||||
| Ref 529084 | Bioorg Med Chem. 2008 Jan 1;16(1):322-35. Epub 2007 Sep 22.Synthesis and pharmacology of 1-deoxy analogs of CP-47,497 and CP-55,940. | ||||
| Ref 529106 | Bioorg Med Chem Lett. 2007 Dec 1;17(23):6505-10. Epub 2007 Oct 1.New 1,8-naphthyridine and quinoline derivatives as CB2 selective agonists. | ||||
| Ref 529170 | J Med Chem. 2007 Dec 27;50(26):6493-500. Epub 2007 Nov 27.Cannabilactones: a novel class of CB2 selective agonists with peripheral analgesic activity. | ||||
| Ref 529434 | Bioorg Med Chem Lett. 2008 May 1;18(9):2820-4. Epub 2008 Apr 4.New tetrazole-based selective anandamide uptake inhibitors. | ||||
| Ref 529515 | Bioorg Med Chem. 2008 Jul 1;16(13):6489-500. Epub 2008 May 20.Exploring the substituent effects on a novel series of C1'-dimethyl-aryl Delta8-tetrahydrocannabinol analogs. | ||||
| Ref 529563 | Bioorg Med Chem. 2008 Aug 1;16(15):7510-5. Epub 2008 Jun 7.Novel sterically hindered cannabinoid CB1 receptor ligands. | ||||
| Ref 529727 | J Med Chem. 2008 Oct 23;51(20):6393-9. Epub 2008 Oct 1.Bornyl- and isobornyl-Delta8-tetrahydrocannabinols: a novel class of cannabinergic ligands. | ||||
| Ref 529838 | J Med Chem. 2008 Dec 25;51(24):7800-5.New analgesics synthetically derived from the paracetamol metabolite N-(4-hydroxyphenyl)-(5Z,8Z,11Z,14Z)-icosatetra-5,8,11,14-enamide. | ||||
| Ref 529872 | Bioorg Med Chem Lett. 2009 Jan 15;19(2):309-13. Epub 2008 Nov 27.CB2 selective sulfamoyl benzamides: optimization of the amide functionality. | ||||
| Ref 529920 | J Med Chem. 2009 Jan 22;52(2):369-78.Discovery of novel CB2 receptor ligands by a pharmacophore-based virtual screening workflow. | ||||
| Ref 530009 | Bioorg Med Chem. 2009 Apr 1;17(7):2842-51. Epub 2009 Feb 21.Synthesis and pharmacological evaluation of coumarin derivatives as cannabinoid receptor antagonists and inverse agonists. | ||||
| Ref 530070 | J Med Chem. 2009 May 14;52(9):3001-9.Conformationally constrained fatty acid ethanolamides as cannabinoid and vanilloid receptor probes. | ||||
| Ref 530200 | Bioorg Med Chem Lett. 2009 Aug 1;19(15):4241-4. Epub 2009 May 29.Fatty acid amide hydrolase inhibitors. Surprising selectivity of chiral azetidine ureas. | ||||
| Ref 530525 | J Med Chem. 2010 Jan 14;53(1):295-315.Indol-3-ylcycloalkyl ketones: effects of N1 substituted indole side chain variations on CB(2) cannabinoid receptor activity. | ||||
| Ref 530597 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1084-9. Epub 2009 Dec 11.Synthesis and SAR of novel imidazoles as potent and selective cannabinoid CB2 receptor antagonists with high binding efficiencies. | ||||
| Ref 530617 | Eur J Med Chem. 2010 Mar;45(3):1133-9. Epub 2009 Dec 16.Discovery of benzhydrylpiperazine derivatives as CB1 receptor inverse agonists via privileged structure-based approach. | ||||
| Ref 530693 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1565-8. Epub 2010 Jan 21.Radiosynthesis of novel carbon-11-labeled triaryl ligands for cannabinoid-type 2 receptor. | ||||
| Ref 530871 | J Med Chem. 2010 May 27;53(10):4028-37.Discovery of N-[(4R)-6-(4-chlorophenyl)-7-(2,4-dichlorophenyl)-2,2-dimethyl-3,4-dihydro-2H-pyrano[2,3-b]pyridin-4-yl]-5-methyl-1H-pyrazole-3-carboxamide (MK-5596) as a novel cannabinoid-1 receptor (CB1R) inverse agonist for the treatment of obesity. | ||||
| Ref 530929 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3750-4. Epub 2010 Apr 21.Dihydro-pyrano[2,3-b]pyridines and tetrahydro-1,8-naphthyridines as CB1 receptor inverse agonists: synthesis, SAR and biological evaluation. | ||||
| Ref 531027 | Bioorg Med Chem. 2010 Aug 1;18(15):5475-82. Epub 2010 Jun 22.Synthesis and pharmacology of 1-methoxy analogs of CP-47,497. | ||||
| Ref 531196 | J Med Chem. 2010 Oct 14;53(19):6996-7010.Novel 1',1'-chain substituted hexahydrocannabinols: 9|A-hydroxy-3-(1-hexyl-cyclobut-1-yl)-hexahydrocannabinol (AM2389) a highly potent cannabinoid receptor 1 (CB1) agonist. | ||||
| Ref 531715 | Cerebroprotective effects of TAK-937, a cannabinoid receptor agonist, on ischemic brain damage in middle cerebral artery occluded rats and non-human primates. Brain Res. 2012 Jan 9;1430:93-100. | ||||
| Ref 532597 | The agonist binding mechanism of human CB2 receptor studied by molecular dynamics simulation, free energy calculation and 3D-QSAR studies. Yao Xue Xue Bao. 2013 Sep;48(9):1436-49. | ||||
| Ref 533602 | The peripheral cannabinoid receptor: adenylate cyclase inhibition and G protein coupling. FEBS Lett. 1995 Nov 13;375(1-2):143-7. | ||||
| Ref 533680 | Activation of the human peripheral cannabinoid receptor results in inhibition of adenylyl cyclase. Mol Pharmacol. 1995 Aug;48(2):352-61. | ||||
| Ref 534133 | Signaling pathway associated with stimulation of CB2 peripheral cannabinoid receptor. Involvement of both mitogen-activated protein kinase and induction of Krox-24 expression. Eur J Biochem. 1996 May1;237(3):704-11. | ||||
| Ref 535198 | Antinociceptive activity of the endogenous fatty acid amide, palmitylethanolamide. Eur J Pharmacol. 2001 May 11;419(2-3):191-8. | ||||
| Ref 536731 | Posttraining activation of CB1 cannabinoid receptors in the CA1 region of the dorsal hippocampus impairs object recognition long-term memory. Neurobiol Learn Mem. 2008 Sep;90(2):374-81. Epub 2008 Jun 3. | ||||
| Ref 543878 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 57). | ||||
| Ref 544411 | Brain CB2 Receptors: Implications for Neuropsychiatric Disorders. Pharmaceuticals (Basel) 2010 August; 3(8): 2517-2553. | ||||
| Ref 544486 | Targeting CB2 receptors and the endocannabinoid system for the treatment of pain. Brain Res Rev. 2009 April; 60(1): 255-266. | ||||
| Ref 547669 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018288) | ||||
| Ref 551296 | Morpholinoalkylindenes as antinociceptive agents: Novel cannabinoid receptor agonists, Bioorg. Med. Chem. Lett. 5(4):381-386 (1995). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
