Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T41666
|
||||
| Former ID |
TTDR00219
|
||||
| Target Name |
Hypoxanthine-guanine phosphoribosyltransferase
|
||||
| Gene Name |
LACZ
|
||||
| Synonyms |
GPRT; Guanine phosphoribosyltransferase; HGPRT; HGPRTase; HPRT; Hypoxanthine phosphoribosyltransferase; LACZ
|
||||
| Target Type |
Research
|
||||
| Function |
Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5- phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.
|
||||
| BioChemical Class |
Pentosyltransferase
|
||||
| Target Validation |
T41666
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.4.2.8
|
||||
| Sequence |
MPIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYD
IKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQ STGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPL WNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL |
||||
| Structure |
1CJB; 2VFA; 3OZF; 3OZG; 1BZY; 1D6N; 1HMP; 1Z7G; 2VFA; 3GEP; 3GGC; 3GGJ; 4IJQ; 4KN6; 4RAB; 4RAC; 4RAD; 4RAN; 4RAO; 4RAQ
|
||||
| Inhibitor | 3h-Pyrazolo[4,3-D]Pyrimidin-7-Ol | Drug Info | [551393] | ||
| 5--Monophosphate-9-Beta-D-Ribofuranosyl Xanthine | Drug Info | [551393] | |||
| 7-Hydroxy-Pyrazolo[4,3-D]Pyrimidine | Drug Info | [551391] | |||
| 9-Deazaguanine | Drug Info | [551393] | |||
| 9-[2-(1-Phosphonobutan-2-yloxy)ethyl]guanine | Drug Info | [530305] | |||
| 9-[2-(1-Phosphonobutan-2-yloxy)ethyl]hypoxanthine | Drug Info | [530305] | |||
| 9-[2-(1-Phosphonopropan-2-yloxy)ethyl]guanine | Drug Info | [530305] | |||
| Acetate Ion | Drug Info | [551393] | |||
| Alpha-Phosphoribosylpyrophosphoric Acid | Drug Info | [551374] | |||
| Carboxylic PRPP | Drug Info | [551393] | |||
| Formic Acid | Drug Info | [551393] | |||
| Formycin B | Drug Info | [551393] | |||
| Guanosine-5',3'-Tetraphosphate | Drug Info | [551393] | |||
| Guanosine-5'-Monophosphate | Drug Info | [551393] | |||
| Inosinic Acid | Drug Info | [551393] | |||
| Pyrophosphate 2- | Drug Info | [551374] | |||
| Pathways | |||||
| KEGG Pathway | Purine metabolism | ||||
| Drug metabolism - other enzymes | |||||
| Metabolic pathways | |||||
| PathWhiz Pathway | Purine Metabolism | ||||
| Reactome | Purine salvage | ||||
| WikiPathways | Nucleotide Metabolism | ||||
| Mesodermal Commitment Pathway | |||||
| Endoderm Differentiation | |||||
| Metabolism of nucleotides | |||||
| References | |||||
| Ref 530305 | Bioorg Med Chem. 2009 Sep 1;17(17):6218-32. Epub 2009 Jul 25.Synthesis of branched 9-[2-(2-phosphonoethoxy)ethyl]purines as a new class of acyclic nucleoside phosphonates which inhibit Plasmodium falciparum hypoxanthine-guanine-xanthine phosphoribosyltransferase. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
