Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T47863
|
||||
| Former ID |
TTDR00765
|
||||
| Target Name |
Tumor-associated calcium signal transducer 1
|
||||
| Gene Name |
EPCAM
|
||||
| Synonyms |
Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; EGP; Epithelial cell surface antigen; Epithelial glycoprotein; Gastrointestinal carcinoma antigen GA733; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; EPCAM
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Head and neck cancer [ICD9: 140-149, 140-229; ICD10: C07-C14, C32-C33] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
|
||||
| BioChemical Class |
Transmembrane protein
|
||||
| UniProt ID | |||||
| Sequence |
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS
KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA EIKEMGEMHRELNA |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| References | |||||
| Ref 521543 | ClinicalTrials.gov (NCT00051675) Phase I Study of a Monoclonal Antibody for Treatment of Advanced Adenocarcinomas. U.S. National Institutes of Health. | ||||
| Ref 522038 | ClinicalTrials.gov (NCT00481936) Study of the Safety of VB6-845 in Patients With Advanced Solid Tumours of Epithelial Origin. U.S. National Institutes of Health. | ||||
| Ref 531707 | EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74. | ||||
| Ref 527313 | ING-1, a monoclonal antibody targeting Ep-CAM in patients with advanced adenocarcinomas. Clin Cancer Res. 2004 Nov 15;10(22):7555-65. | ||||
| Ref 528423 | Drug evaluation: IGN-101--an anti-EpCAM murine antibody vaccine for cancer. Curr Opin Mol Ther. 2006 Aug;8(4):358-65. | ||||
| Ref 531707 | EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
