Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T49639
|
||||
| Former ID |
TTDR00169
|
||||
| Target Name |
Heat shock protein 70
|
||||
| Gene Name |
HSF1
|
||||
| Synonyms |
Chaperone protein dnaK; HSP70; Heat shock 70 kDa protein; Molecular chaperone Hsp70; HSF1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Atrial fibrillation [ICD9: 272, 427.31; ICD10: E78, I48] | ||||
| Amyotrophic lateral sclerosis [ICD9: 335.2; ICD10: G12.2] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Diabetic neuropathy [ICD9: 250, 250.6, 356.0, 356.8; ICD10: E11.40] | |||||
| Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | |||||
| Gastrointestinal cancers [ICD9: 150-159; ICD10: C15-C26] | |||||
| Herpes simplex virus infection [ICD9: 54; ICD10: B00] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Metastasis [ICD10: C00-C97] | |||||
| Function |
Plays an essential role in the initiation of phage lambda dna replication, where it acts in an atp-dependent fashion with the dnaj protein to release lambda o and p proteins from the preprimosomal complex. Dnak is also involved in chromosomaldna replication.
|
||||
| BioChemical Class |
HSF family
|
||||
| Target Validation |
T49639
|
||||
| UniProt ID | |||||
| Sequence |
MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT SVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPY SAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEE PPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGR PPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSP SVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGS VDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS |
||||
| Structure |
2LDU; 1DKX; 1DKY; 1DKZ; 1Q5L; 2BPR; 2KHO; 3DPO; 3DPP
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | AEG-33773 | Drug Info | Phase 2 | Diabetic neuropathy | [522652] |
| AG-858 | Drug Info | Phase 2 | Leukemia | [521552] | |
| AG-707 | Drug Info | Phase 1 | Herpes simplex virus infection | [521737] | |
| Enkastim-ev | Drug Info | Phase 1 | Cancer | [551168] | |
| H-103 | Drug Info | Phase 1 | Metastasis | [529874] | |
| Minnelide 001 | Drug Info | Phase 1 | Gastrointestinal cancers | [524410] | |
| Bimoclomol | Drug Info | Discontinued in Phase 2 | Diabetes | [545697] | |
| BRX-005 | Drug Info | Discontinued in Phase 2 | Amyotrophic lateral sclerosis | [534488] | |
| NK-1001 | Drug Info | Discontinued in Phase 2 | Atrial fibrillation | [549188] | |
| Inhibitor | AEG-33773 | Drug Info | [551193] | ||
| ELLAGIC ACID | Drug Info | [531262] | |||
| NSC-119910 | Drug Info | [531262] | |||
| NSC-119911 | Drug Info | [531262] | |||
| NSC-119913 | Drug Info | [531262] | |||
| Modulator | AG-707 | Drug Info | [531564] | ||
| Bimoclomol | Drug Info | [526247] | |||
| BRX-005 | Drug Info | [525882] | |||
| Enkastim-ev | Drug Info | ||||
| H-103 | Drug Info | [529874] | |||
| Minnelide 001 | Drug Info | [1572591] | |||
| NK-1001 | Drug Info | [532907] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| References | |||||
| Ref 521552 | ClinicalTrials.gov (NCT00058747) AG-858 in Patients Who Are Cytogenetically Positive After Treatment With Gleevec . U.S. National Institutes of Health. | ||||
| Ref 521737 | ClinicalTrials.gov (NCT00231049) Trial Evaluating Safety, Tolerability and Immune Response of AG-707. U.S. National Institutes of Health. | ||||
| Ref 522652 | ClinicalTrials.gov (NCT00891683) Safety and Efficacy of AEG33773 Versus Placebo in Patients With Painful Diabetic Peripheral Neuropathy. U.S. National Institutes of Health. | ||||
| Ref 524410 | ClinicalTrials.gov (NCT01927965) Study of Minnelide in Patients With Advanced GI Tumors. U.S. National Institutes of Health. | ||||
| Ref 529874 | A phase I trial of intratumoral administration of recombinant oncolytic adenovirus overexpressing HSP70 in advanced solid tumor patients. Gene Ther. 2009 Mar;16(3):376-82. | ||||
| Ref 534488 | Bimoclomol: a nontoxic, hydroxylamine derivative with stress protein-inducing activity and cytoprotective effects. Nat Med. 1997 Oct;3(10):1150-4. | ||||
| Ref 545697 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004241) | ||||
| Ref 525882 | Cardiovascular effects of BRX-005 comparison to bimoclomol. Life Sci. 2000 Aug 25;67(14):1783-9. | ||||
| Ref 526247 | Bimoclomol elevates heat shock protein 70 and cytoprotects rat neonatal cardiomyocytes. Eur J Pharmacol. 2002 Jan 18;435(1):73-7. | ||||
| Ref 529874 | A phase I trial of intratumoral administration of recombinant oncolytic adenovirus overexpressing HSP70 in advanced solid tumor patients. Gene Ther. 2009 Mar;16(3):376-82. | ||||
| Ref 531262 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). | ||||
| Ref 531564 | A heat shock protein based polyvalent vaccine targeting HSV-2: CD4(+) and CD8(+) cellular immunity and protective efficacy. Vaccine. 2011 Nov 3;29(47):8530-41. | ||||
| Ref 532907 | Novel therapeutic targets in the management of atrial fibrillation. Am J Cardiovasc Drugs. 2014 Dec;14(6):403-21. | ||||
| Ref 544425 | Preparation of a Heat Shock Proteins 70-based Vaccine from DC-tumor fusion cells. Methods Mol Biol. 2011; 787: 255-265. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
