Target General Infomation
Target ID
T57011
Former ID
TTDC00192
Target Name
mRNA of Intercellularadhesion molecule-1
Gene Name
ICAM1
Synonyms
CD54 antigen; ICAM-1; Major group rhinovirus receptor; ICAM1
Target Type
Successful
Disease Crohn's disease; Ulcerative colitis [ICD9: 555, 556, 556.9; ICD10: K50, K50-K52, K51]
Pouchitis [ICD10: K91.8]
Transplant rejection [ICD9: 279.5, 996; ICD10: D89.8, T86]
Function
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans- endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus.
BioChemical Class
Target of antisense drug
Target Validation
T57011
UniProt ID
Sequence
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Drugs and Mode of Action
Drug(s) ISIS 1570 Drug Info Approved Pouchitis [551871]
Alicaforsen Drug Info Phase 2 Crohn's disease; Ulcerative colitis [551048]
INXC-ICAM1 Drug Info Terminated Transplant rejection [525632]
Inhibitor A-286982 Drug Info [531049]
Dehydropipernonaline Drug Info [529623]
Pellitorin Drug Info [529623]
PIPERNONALINE Drug Info [529623]
PIPERROLEIN B Drug Info [529623]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway NF-kappa B signaling pathway
Cell adhesion molecules (CAMs)
Natural killer cell mediated cytotoxicity
TNF signaling pathway
Leukocyte transendothelial migration
African trypanosomiasis
Malaria
Staphylococcus aureus infection
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Rheumatoid arthritis
Viral myocarditis
NetPath Pathway IL5 Signaling Pathway
IL1 Signaling Pathway
TSH Signaling Pathway
IL6 Signaling Pathway
IL2 Signaling Pathway
ID Signaling Pathway
TWEAK Signaling Pathway
RANKL Signaling Pathway
TNFalpha Signaling Pathway
Pathway Interaction Database Thromboxane A2 receptor signaling
Glucocorticoid receptor regulatory network
amb2 Integrin signaling
Beta2 integrin cell surface interactions
Reactome Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions
Interferon gamma signaling
WikiPathways Type II interferon signaling (IFNG)
IL1 and megakaryotyces in obesity
Human Complement System
Spinal Cord Injury
Interleukin-11 Signaling Pathway
RANKL/RANK Signaling Pathway
Integrin cell surface interactions
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Folate Metabolism
Vitamin B12 Metabolism
Selenium Micronutrient Network
References
Ref 525632ISIS 2302. INXC ICAM1, Oligo-TCS. Drugs R D. 1999 Jan;1(1):85-6.
Ref 551048Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2011).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 525632ISIS 2302. INXC ICAM1, Oligo-TCS. Drugs R D. 1999 Jan;1(1):85-6.
Ref 529623Bioorg Med Chem Lett. 2008 Aug 15;18(16):4544-6. Epub 2008 Jul 15.Alkamides from the fruits of Piper longum and Piper nigrum displaying potent cell adhesion inhibition.
Ref 531049Bioorg Med Chem Lett. 2010 Sep 1;20(17):5269-73. Epub 2010 Jul 23.Discovery of tetrahydroisoquinoline (THIQ) derivatives as potent and orally bioavailable LFA-1/ICAM-1 antagonists.
Ref 549600US patent application no. 5,789,573, Antisense inhibition of ICAM-1, E-selectin, and CMV IE1/IE2.
Ref 549645US patent application no. 6,300,491, Oligonucleotide inhibition of cell adhesion.
Ref 551048Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2011).
Ref 551054Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2009).

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.