Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T61657
|
||||
| Former ID |
TTDR01191
|
||||
| Target Name |
Retinoic acid receptor beta
|
||||
| Gene Name |
RARB
|
||||
| Synonyms |
HBV-activated protein; RAR-beta; RAR-epsilon; RARB
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Function |
Receptor for retinoic acid. Retinoicacid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. TheRXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence or presence of hormone ligand, acts mainly as an activator of gene expression due to weak binding to corepressors. In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function.
|
||||
| BioChemical Class |
Nuclear hormone receptor
|
||||
| UniProt ID | |||||
| Sequence |
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ |
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Pathways in cancer | ||||
| Small cell lung cancer | |||||
| Non-small cell lung cancer | |||||
| Reactome | Nuclear Receptor transcription pathway | ||||
| WikiPathways | Vitamin A and Carotenoid Metabolism | ||||
| Nuclear Receptors in Lipid Metabolism and Toxicity | |||||
| Mesodermal Commitment Pathway | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Nuclear Receptors | |||||
| References | |||||
| Ref 525680 | Therapeutic applications for ligands of retinoid receptors. Curr Pharm Des. 2000 Jan;6(1):25-58. | ||||
| Ref 526744 | Identification of synthetic retinoids with selectivity for human nuclear retinoic acid receptor gamma. Biochem Biophys Res Commun. 1992 Jul 31;186(2):977-83. | ||||
| Ref 527177 | Rational design of RAR-selective ligands revealed by RARbeta crystal stucture. EMBO Rep. 2004 Sep;5(9):877-82. | ||||
| Ref 527881 | Discovery of a potent, orally available, and isoform-selective retinoic acid beta2 receptor agonist. J Med Chem. 2005 Dec 1;48(24):7517-9. | ||||
| Ref 531992 | Tamibarotene: a candidate retinoid drug for Alzheimer's disease. Biol Pharm Bull. 2012;35(8):1206-12. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
