Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T64830
|
||||
| Former ID |
TTDC00253
|
||||
| Target Name |
Somatostatin receptor type 5
|
||||
| Gene Name |
SSTR5
|
||||
| Synonyms |
SS5R; Somatostatin receptor 5; SSTR5
|
||||
| Target Type |
Successful
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Cushing's disease [ICD9: 255; ICD10: E24.0] | |||||
| Neuroendocrine cancer [ICD10: C7A] | |||||
| Function |
Receptor for somatostatin 28 and to a lesser extent for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Increases cell growth inhibition activity of SSTR2 following heterodimerization.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T64830
|
||||
| UniProt ID | |||||
| Sequence |
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ TSKL |
||||
| Drugs and Mode of Action | |||||
| Modulator | 99mTc-MIP-1407 | Drug Info | [543791] | ||
| FR-121196 | Drug Info | [533791] | |||
| Agonist | CGP 23996 | Drug Info | [534665] | ||
| L-817,818 | Drug Info | [534729] | |||
| SRIF-14 | Drug Info | [534665] | |||
| Inhibitor | CytotoxinPeptide Conjugate | Drug Info | [526564] | ||
| D-Phe-c[Cys-Tyr-D-Trp-Lys-Val-Cys]-Asp-NH2 | Drug Info | [527802] | |||
| Des-AA1,2,4,12,13-[D-Trp8]SRIF | Drug Info | [527385] | |||
| Des-AA1,2,4,13-[D-Trp8]SRIF | Drug Info | [527385] | |||
| Des-AA1,2,4,5,13-[D-Trp8]-SRIF | Drug Info | [527385] | |||
| Des-AA1,2,4,5-[D-Trp8]SRIF | Drug Info | [527385] | |||
| Des-AA1,2,5,12,13-[D-Trp8]SRIF | Drug Info | [527385] | |||
| Des-AA1,2,5-[D-Trp8,Tyr11]SRIF | Drug Info | [527384] | |||
| Des-AA5-[D-Trp8]SRIF | Drug Info | [527384] | |||
| H-D-Phe-Cys-Tyr-D-Trp-Lys-Val-Cys-Thr-NH2 | Drug Info | [527802] | |||
| H-D-Phe-c[Cys-Ala-D-Trp-Lys-Thr-Cys]-Thr-NH2 | Drug Info | [528320] | |||
| H-DPhe-c[Cys-Phe-DTrp-Lys-Thr-Cys]-Thr-NH2 | Drug Info | [528320] | |||
| ODT-8 | Drug Info | [527385] | |||
| Pasireotide | Drug Info | [543791] | |||
| PTR-3046 | Drug Info | [529856] | |||
| Radiolabeled octreotide derivative | Drug Info | [527508] | |||
| SOMATOSTATIN | Drug Info | [527802] | |||
| SRIF-28 | Drug Info | [531062] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | cAMP signaling pathway | ||||
| Neuroactive ligand-receptor interaction | |||||
| PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
| Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
| Reactome | Peptide ligand-binding receptors | ||||
| G alpha (i) signalling events | |||||
| WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
| Peptide GPCRs | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 523209 | ClinicalTrials.gov (NCT01220167) Three-way Crossover Comparative Water-effect Bioavailability to Compare Ondansetron ODFS 8mg With and Without Water With Zofran ODT 8mg Without Water in 18 Healthy Participants Under Fasting Conditions. U.S. National Institutes of Health. | ||||
| Ref 525297 | ClinicalTrials.gov (NCT02527993) Treatment of Hypoglycemia Following Gastric Bypass Surgery. | ||||
| Ref 526564 | Bioorg Med Chem Lett. 2003 Mar 10;13(5):799-803.An adjustable release rate linking strategy for cytotoxin-peptide conjugates. | ||||
| Ref 527384 | J Med Chem. 2005 Jan 27;48(2):507-14.Somatostatin receptor 1 selective analogues: 2. N(alpha)-Methylated scan. | ||||
| Ref 527385 | J Med Chem. 2005 Jan 27;48(2):515-22.Somatostatin receptor 1 selective analogues: 3. Dicyclic peptides. | ||||
| Ref 527508 | J Med Chem. 2005 Apr 21;48(8):2778-89.N-terminal sugar conjugation and C-terminal Thr-for-Thr(ol) exchange in radioiodinated Tyr3-octreotide: effect on cellular ligand trafficking in vitro and tumor accumulation in vivo. | ||||
| Ref 527802 | J Med Chem. 2005 Oct 20;48(21):6643-52.Discovery of iodinated somatostatin analogues selective for hsst2 and hsst5 with excellent inhibition of growth hormone and prolactin release from rat pituitarycells. | ||||
| Ref 528320 | J Med Chem. 2006 Jul 27;49(15):4487-96.Novel sst2-selective somatostatin agonists. Three-dimensional consensus structure by NMR. | ||||
| Ref 529856 | J Med Chem. 2009 Jan 8;52(1):95-104.Highly potent 4-amino-indolo[2,3-c]azepin-3-one-containing somatostatin mimetics with a range of sst receptor selectivities. | ||||
| Ref 531062 | J Med Chem. 2010 Aug 26;53(16):6188-97.Novel octreotide dicarba-analogues with high affinity and different selectivity for somatostatin receptors. | ||||
| Ref 533791 | Role of somatostatin in the augmentation of hippocampal long-term potentiation by FR121196, a putative cognitive enhancer. Eur J Pharmacol. 1993 Sep 7;241(1):27-34. | ||||
| Ref 534665 | [125I][Tyr3]octreotide labels human somatostatin sst2 and sst5 receptors. Eur J Pharmacol. 1998 May 8;348(2-3):311-20. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
