Target General Infomation
Target ID
T68698
Former ID
TTDR00957
Target Name
Adenosylhomocysteinase
Gene Name
AHCY
Synonyms
AdoHcyase; S-adenosyl-L-homocysteine hydrolase; SAH hydrolase; AHCY
Target Type
Discontinued
Function
Adenosylhomocysteine is a competitiveinhibitor of S- adenosyl-L-methionine-dependent methyl transferase reactions; therefore adenosylhomocysteinase may play a key role in the control of methylations via regulation of the intracellular concentration of adenosylhomocysteine.
BioChemical Class
Ether hydrolase
Target Validation
T68698
UniProt ID
EC Number
EC 3.3.1.1
Sequence
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF
KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY
Drugs and Mode of Action
Drug(s) ARISTEROMYCIN Drug Info Terminated Discovery agent [546315]
Neplanocin A Drug Info Terminated Discovery agent [544782]
Inhibitor 3'-Oxo-Adenosine Drug Info [551391]
4(Z)-(5'-Deoxyadenosin-5'-ylidene)butanoic acid Drug Info [529453]
5'-deoxy-5'-ureidoadenosine Drug Info [528908]
5'-S-ethyl-5'-thioadenosine Drug Info [551374]
5(E)-(5'-Deoxyadenosin-5'-ylidene)pentanoic acid Drug Info [529453]
5-methylenearisteromycin Drug Info [529335]
ARISTEROMYCIN Drug Info [529335]
D-Eritadenine Drug Info [551393]
DZNep Drug Info [533455]
ERITADENINE Drug Info [530323]
FLUORO-NEPLANOCIN A Drug Info [527252]
Isopropyl Alcohol Drug Info [551374]
Neplanocin A Drug Info [537918]
Nicotinamide-Adenine-Dinucleotide Drug Info [551393]
NORARISTEROMYCIN Drug Info [529398]
Pathways
BioCyc Pathway Superpathway of methionine degradation
Methionine degradation
Cysteine biosynthesis
KEGG Pathway Cysteine and methionine metabolism
Metabolic pathways
PathWhiz Pathway Selenoamino Acid Metabolism
Betaine Metabolism
Methionine Metabolism
WikiPathways Metabolism of amino acids and derivatives
Trans-sulfuration and one carbon metabolism
One Carbon Metabolism
Trans-sulfuration pathway
Phase II conjugation
Folate Metabolism
References
Ref 544782Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001045)
Ref 546315Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007402)
Ref 527252Bioorg Med Chem Lett. 2004 Nov 15;14(22):5641-4.Synthesis of 5'-substituted fluoro-neplanocin A analogues: importance of a hydrogen bonding donor at 5'-position for the inhibitory activity of S-adenosylhomocysteine hydrolase.
Ref 528908Bioorg Med Chem Lett. 2007 Aug 15;17(16):4456-9. Epub 2007 Jun 8.Design, synthesis, and molecular modeling studies of 5'-deoxy-5'-ureidoadenosine: 5'-ureido group as multiple hydrogen bonding donor in the active site of S-adenosylhomocysteine hydrolase.
Ref 529335Bioorg Med Chem. 2008 Apr 1;16(7):3809-15. Epub 2008 Jan 30.Synthesis of 2-modified aristeromycins and their analogs as potent inhibitors against Plasmodium falciparum S-adenosyl-L-homocysteine hydrolase.
Ref 529398Bioorg Med Chem Lett. 2008 Apr 15;18(8):2615-8. Epub 2008 Mar 14.Synthesis of 4'-modified noraristeromycins to clarify the effect of the 4'-hydroxyl groups for inhibitory activity against S-adenosyl-L-homocysteine hydrolase.
Ref 529453Bioorg Med Chem. 2008 May 15;16(10):5424-33. Epub 2008 Apr 12.Synthesis of 5'-functionalized nucleosides: S-Adenosylhomocysteine analogues with the carbon-5' and sulfur atoms replaced by a vinyl or halovinyl unit.
Ref 530323Bioorg Med Chem. 2009 Sep 15;17(18):6707-14. Epub 2009 Jul 28.A new structural class of S-adenosylhomocysteine hydrolase inhibitors.
Ref 5334553-Deazaneplanocin: a new and potent inhibitor of S-adenosylhomocysteine hydrolase and its effects on human promyelocytic leukemia cell line HL-60. Biochem Biophys Res Commun. 1986 Mar 13;135(2):688-94.
Ref 537918Molecular approaches for the treatment of hemorrhagic fever virus infections. Antiviral Res. 1993 Sep;22(1):45-75.
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 551391DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.