Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T72702
|
||||
| Former ID |
TTDR00396
|
||||
| Target Name |
Tissue factor
|
||||
| Gene Name |
F3
|
||||
| Synonyms |
CD142 antigen; Coagulation factor III; TF; Thromboplastin; F3
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Adult respiratory distress syndrome [ICD9: 518.5, 518.82; ICD10: J80] | ||||
| Bleeding [ICD9: 444, 453; ICD10: I74, I80-I82] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Function |
Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assemblyand propagation of the coagulation protease cascade.
|
||||
| BioChemical Class |
Transmembrane protein
|
||||
| Target Validation |
T72702
|
||||
| UniProt ID | |||||
| Sequence |
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| KEGG Pathway | Complement and coagulation cascades | ||||
| NetPath Pathway | IL4 Signaling Pathway | ||||
| TGF_beta_Receptor Signaling Pathway | |||||
| TWEAK Signaling Pathway | |||||
| PANTHER Pathway | Angiogenesis | ||||
| Blood coagulation | |||||
| PathWhiz Pathway | Coagulation | ||||
| Reactome | Extrinsic Pathway of Fibrin Clot Formation | ||||
| WikiPathways | Complement and Coagulation Cascades | ||||
| Formation of Fibrin Clot (Clotting Cascade) | |||||
| References | |||||
| Ref 522632 | ClinicalTrials.gov (NCT00879606) Anti-TF Antibody (ALT-836) to Treat Septic Patients With Acute Lung Injury or Acute Respiratory Distress Syndrome. U.S. National Institutes of Health. | ||||
| Ref 529454 | J Med Chem. 2008 Jun 12;51(11):3077-80. Epub 2008 May 7.Novel 3-carboxamide-coumarins as potent and selective FXIIa inhibitors. | ||||
| Ref 533187 | ImmunoPET of tissue factor expression in triple-negative breast cancer with a radiolabeled antibody Fab fragment. Eur J Nucl Med Mol Imaging. 2015 Jul;42(8):1295-303. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
