Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T72835
|
||||
| Former ID |
TTDC00098
|
||||
| Target Name |
E-selectin
|
||||
| Gene Name |
SELE
|
||||
| Synonyms |
CD62E; CD62E antigen; ELAM-1; Endothelial leukocyte adhesion molecule 1; LECAM2; Leukocyte-endothelial cell adhesion molecule 2; SELE
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Asthma [ICD10: J45] | ||||
| Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | |||||
| Chronic obstructive pulmonary disease; Psoriatic disorder; Atopic dermatitis [ICD9:490-492, 494-496, 691.8, 692.9, 696; ICD10: J40-J44, J47, L20, L20-L30, L40] | |||||
| Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
| Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
| Function |
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
|
||||
| BioChemical Class |
Selectin/LECAM
|
||||
| Target Validation |
T72835
|
||||
| UniProt ID | |||||
| Sequence |
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD GSYQKPSYIL |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | GMI-1070 | Drug Info | Phase 3 | Asthma | [530945], [531721], [543059] |
| CY-1503 | Drug Info | Phase 2/3 | Hypertension | [521727] | |
| Bimosiamose | Drug Info | Phase 2a | Chronic obstructive pulmonary disease; Psoriatic disorder; Atopic dermatitis | [536958] | |
| Bimosiamose | Drug Info | Phase 2 | Asthma | [536958] | |
| GMI-1271 | Drug Info | Phase 1 | Acute myeloid leukemia | [524962] | |
| SMART anti-E/P selectin | Drug Info | Discontinued in Phase 1 | Asthma | [546436] | |
| GI-270384X | Drug Info | Terminated | Inflammatory bowel disease | [529903] | |
| Inhibitor | 1na | Drug Info | [551393] | ||
| Bimosiamose | Drug Info | [536136], [536502], [536763] | |||
| Efomycine M | Drug Info | [535688] | |||
| Fucose | Drug Info | [551393] | |||
| GMI-1070 | Drug Info | [530945], [531721], [544142] | |||
| GMI-1271 | Drug Info | [550826] | |||
| O-Sialic Acid | Drug Info | [551374] | |||
| Modulator | CY-1503 | Drug Info | [533630] | ||
| GI-270384X | Drug Info | [529903] | |||
| SMART anti-E/P selectin | Drug Info | [526458] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cell adhesion molecules (CAMs) | ||||
| TNF signaling pathway | |||||
| African trypanosomiasis | |||||
| Malaria | |||||
| NetPath Pathway | IL5 Signaling Pathway | ||||
| IL4 Signaling Pathway | |||||
| TNFalpha Signaling Pathway | |||||
| ID Signaling Pathway | |||||
| Pathway Interaction Database | Thromboxane A2 receptor signaling | ||||
| Glucocorticoid receptor regulatory network | |||||
| ATF-2 transcription factor network | |||||
| Reactome | Cell surface interactions at the vascular wall | ||||
| WikiPathways | Human Complement System | ||||
| TNF alpha Signaling Pathway | |||||
| Cell surface interactions at the vascular wall | |||||
| References | |||||
| Ref 521727 | ClinicalTrials.gov (NCT00226369) Cylexin for Reduction of Reperfusion Injury in Infant Heart Surgery. U.S. National Institutes of Health. | ||||
| Ref 524962 | ClinicalTrials.gov (NCT02271113) Phase I Study to Assess Safety and Pharmacokinetics of GMI-1271 in Healthy Adult Subjects. U.S. National Institutes of Health. | ||||
| Ref 529903 | Inhibition of endothelial cell adhesion molecule expression improves colonic hyperalgaesia. Neurogastroenterol Motil. 2009 Feb;21(2):189-96. | ||||
| Ref 530945 | GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 Sep 9;116(10):1779-86. | ||||
| Ref 531721 | Deal watch: Pfizer deal for selectin inhibitor highlights potential of glycomimetic drugs. Nat Rev Drug Discov. 2011 Dec 1;10(12):890. | ||||
| Ref 526458 | HuEP5C7 as a humanized monoclonal anti-E/P-selectin neurovascular protective strategy in a blinded placebo-controlled trial of nonhuman primate stroke. Circ Res. 2002 Nov 15;91(10):907-14. | ||||
| Ref 529903 | Inhibition of endothelial cell adhesion molecule expression improves colonic hyperalgaesia. Neurogastroenterol Motil. 2009 Feb;21(2):189-96. | ||||
| Ref 530945 | GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 Sep 9;116(10):1779-86. | ||||
| Ref 531721 | Deal watch: Pfizer deal for selectin inhibitor highlights potential of glycomimetic drugs. Nat Rev Drug Discov. 2011 Dec 1;10(12):890. | ||||
| Ref 533630 | Adjunctive selectin blockade successfully reduces infarct size beyond thrombolysis in the electrolytic canine coronary artery model. Circulation. 1995 Aug 1;92(3):492-9. | ||||
| Ref 535688 | Interfering with leukocyte rolling--a promising therapeutic approach in inflammatory skin disorders? Trends Pharmacol Sci. 2003 Feb;24(2):49-52. | ||||
| Ref 536136 | Bimosiamose, an inhaled small-molecule pan-selectin antagonist, attenuates late asthmatic reactions following allergen challenge in mild asthmatics: a randomized, double-blind, placebo-controlled clinical cross-over-trial. Pulm Pharmacol Ther. 2006;19(4):233-41. Epub 2005 Sep 1. | ||||
| Ref 536502 | The pharmacokinetics of subcutaneously injected Bimosiamose disodium in healthy male volunteers. Biopharm Drug Dispos. 2007 Dec;28(9):475-84. | ||||
| Ref 536763 | Effects of the pan-selectin antagonist bimosiamose (TBC1269) in experimental human endotoxemia. Shock. 2008 Apr;29(4):475-82. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
