Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T77664
|
||||
| Former ID |
TTDC00096
|
||||
| Target Name |
Interferon gamma
|
||||
| Gene Name |
IFNG
|
||||
| Synonyms |
IFN-gamma; Immune interferon; IFNG
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | B-cell lymphoma [ICD9: 202.8; ICD10: C85.1] | ||||
| Basal cell cancer [ICD9: 140-229, 173; ICD10: C44] | |||||
| Discoid lupus erythematosus; Systemic lupus erythematosus [ICD9:695.4, 710; ICD10: L93.0, M32] | |||||
| Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
| Inflammatory bowel disease; Rheumatoid arthritis [ICD9: 555, 556, 710-719, 714; ICD10: K50, K51, M00-M25, M05-M06] | |||||
| Psoriatic disorder [ICD9: 696; ICD10: L40] | |||||
| Pustular palmoplantar psoriasis; Multiple sclerosis [ICD9: 340, 696, 696.1; ICD10: G35, L40, L40.3] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Function |
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
|
||||
| BioChemical Class |
Cytokine: interferon
|
||||
| Target Validation |
T77664
|
||||
| UniProt ID | |||||
| Sequence |
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Fumaric acid | Drug Info | Phase 3 | Pustular palmoplantar psoriasis; Multiple sclerosis | [536837] |
| VIR-201 | Drug Info | Phase 1/2 | Human immunodeficiency virus infection | [546793] | |
| AMG 811 | Drug Info | Phase 1 | Discoid lupus erythematosus; Systemic lupus erythematosus | [548727] | |
| CIGB-128 | Drug Info | Phase 1 | Basal cell cancer | [549462] | |
| VPM-4-001 | Drug Info | Preclinical | Prostate cancer | [548240] | |
| CRx-191 | Drug Info | Discontinued in Phase 2 | Psoriatic disorder | [548453] | |
| Fontolizumab | Drug Info | Discontinued in Phase 2 | Inflammatory bowel disease; Rheumatoid arthritis | [536651] | |
| TG-1042 | Drug Info | Discontinued in Phase 2 | B-cell lymphoma | [546783] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Proteasome | ||||
| Cytokine-cytokine receptor interaction | |||||
| HIF-1 signaling pathway | |||||
| Regulation of autophagy | |||||
| TGF-beta signaling pathway | |||||
| Osteoclast differentiation | |||||
| Antigen processing and presentation | |||||
| Jak-STAT signaling pathway | |||||
| Natural killer cell mediated cytotoxicity | |||||
| T cell receptor signaling pathway | |||||
| Type I diabetes mellitus | |||||
| Salmonella infection | |||||
| Leishmaniasis | |||||
| Chagas disease (American trypanosomiasis) | |||||
| African trypanosomiasis | |||||
| Malaria | |||||
| Toxoplasmosis | |||||
| Amoebiasis | |||||
| Tuberculosis | |||||
| Measles | |||||
| Influenza A | |||||
| Herpes simplex infection | |||||
| Epstein-Barr virus infection | |||||
| Inflammatory bowel disease (IBD) | |||||
| Systemic lupus erythematosus | |||||
| Rheumatoid arthritis | |||||
| Allograft rejection | |||||
| Graft-versus-host disease | |||||
| NetPath Pathway | IL1 Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| IL2 Signaling Pathway | |||||
| Leptin Signaling Pathway | |||||
| PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
| Interferon-gamma signaling pathway | |||||
| Pathway Interaction Database | IL27-mediated signaling events | ||||
| IL12-mediated signaling events | |||||
| Calcineurin-regulated NFAT-dependent transcription in lymphocytes | |||||
| SHP2 signaling | |||||
| Regulation of Telomerase | |||||
| Glucocorticoid receptor regulatory network | |||||
| IL2-mediated signaling events | |||||
| IFN-gamma pathway | |||||
| ATF-2 transcription factor network | |||||
| AP-1 transcription factor network | |||||
| IL23-mediated signaling events | |||||
| PDGFR-alpha signaling pathway | |||||
| Calcium signaling in the CD4+ TCR pathway | |||||
| Downstream signaling in na& | |||||
| #xef | |||||
| ve CD8+ T cells | |||||
| IL12 signaling mediated by STAT4 | |||||
| Reactome | Interferon gamma signaling | ||||
| Regulation of IFNG signaling | |||||
| WikiPathways | Type II interferon signaling (IFNG) | ||||
| Senescence and Autophagy in Cancer | |||||
| TGF Beta Signaling Pathway | |||||
| Cytokines and Inflammatory Response | |||||
| Hypertrophy Model | |||||
| Inflammatory Response Pathway | |||||
| Aryl Hydrocarbon Receptor Pathway | |||||
| IL1 and megakaryotyces in obesity | |||||
| Cytodifferentiation (Part 3 of 3) | |||||
| Spinal Cord Injury | |||||
| Allograft Rejection | |||||
| Interferon gamma signaling | |||||
| Proteasome Degradation | |||||
| Folate Metabolism | |||||
| Vitamin B12 Metabolism | |||||
| Selenium Micronutrient Network | |||||
| References | |||||
| Ref 536837 | Emerging oral drugs for multiple sclerosis. Expert Opin Emerg Drugs. 2008 Sep;13(3):465-77. | ||||
| Ref 546783 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010265) | ||||
| Ref 546793 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010310) | ||||
| Ref 548240 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023655) | ||||
| Ref 548453 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025635) | ||||
| Ref 528943 | Drug evaluation: TG-1042, an adenovirus-mediated IFNgamma gene delivery for the intratumoral therapy of primary cutaneous lymphomas. Curr Opin Investig Drugs. 2007 Jun;8(6):493-8. | ||||
| Ref 530762 | BioPartnering North America--Programs from Pharma in Europe and the Middle East. IDrugs. 2010 Mar;13(3):162-5. | ||||
| Ref 532955 | Pharmacokinetic and pharmacodynamic relationship of AMG 811, an anti-IFN-gamma IgG1 monoclonal antibody, in patients with systemic lupus erythematosus. Pharm Res. 2015 Feb;32(2):640-53. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
