Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T79591
|
||||
| Former ID |
TTDS00381
|
||||
| Target Name |
Thyroid hormone receptor alpha
|
||||
| Gene Name |
THRA
|
||||
| Synonyms |
C-erbA-1; C-erbA-alpha; EAR-7; EAR7; THRA
|
||||
| Target Type |
Successful
|
||||
| Disease | Hypothyroidism of any etiology [ICD10: R68, T68] | ||||
| Hypothyroidism [ICD9: 244; ICD10: E03] | |||||
| High cholesterol levels in blood [ICD10: E78.0] | |||||
| Wound healing [ICD10: T14.0-T14.1] | |||||
| Function |
Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine.
|
||||
| BioChemical Class |
Nuclear hormone receptor
|
||||
| Target Validation |
T79591
|
||||
| UniProt ID | |||||
| Sequence |
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVC EDLAGNAASP |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Dextrothyroxine Sodium | Drug Info | Approved | High cholesterol levels in blood | [551871] |
| Levothyroxine | Drug Info | Approved | Hypothyroidism | [467866], [536138] | |
| Liothyronine | Drug Info | Approved | Hypothyroidism of any etiology | [551871] | |
| BCT303 | Drug Info | Phase 2 | Hypothyroidism | [549461] | |
| tiratricol | Drug Info | Clinical trial | Wound healing | [539702] | |
| Inhibitor | (3,5-Dibromo-4-hexyloxy-phenyl)-acetic acid | Drug Info | [527532] | ||
| (E)-1-(4-heptylphenyl)but-2-en-1-one | Drug Info | [529081] | |||
| (Z)-4-(4-hexylphenylamino)-4-oxobut-2-enoic acid | Drug Info | [529081] | |||
| 1-(4-hexylphenyl)-3-morpholinopropan-1-one | Drug Info | [529081] | |||
| 3-(3,5-Dibromo-4-hexyloxy-phenyl)-propionic acid | Drug Info | [527532] | |||
| 3-(4-(benzyloxy)-3,5-dibromophenyl)propanoic acid | Drug Info | [528640] | |||
| 3-(dibutylamino)-1-(4-hexylphenyl)propan-1-one | Drug Info | [529081] | |||
| 3-(dimethylamino)-1-(4-hexylphenyl)propan-1-one | Drug Info | [529081] | |||
| 3-bromo-1-(4-hexylphenyl)propan-1-one | Drug Info | [529081] | |||
| 4-(4-hexylphenyl)-4-oxobut-2-enoic acid | Drug Info | [529081] | |||
| 4-hexylphenyl propiolate | Drug Info | [529081] | |||
| Detrothyronine | Drug Info | [527923] | |||
| Modulator | BCT303 | Drug Info | [1572591] | ||
| Dextrothyroxine Sodium | Drug Info | [556264] | |||
| Antagonist | Levothyroxine | Drug Info | [536362], [536861] | ||
| Liothyronine | Drug Info | [536362], [536494] | |||
| Agonist | rT3 | Drug Info | [531482] | ||
| tiratricol | Drug Info | [531482] | |||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| Thyroid hormone signaling pathway | |||||
| Pathway Interaction Database | RXR and RAR heterodimerization with other nuclear receptor | ||||
| Reactome | Nuclear Receptor transcription pathway | ||||
| WikiPathways | Endochondral Ossification | ||||
| Nuclear Receptors | |||||
| References | |||||
| Ref 467866 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4627). | ||||
| Ref 536138 | Current methodology to assess bioequivalence of levothyroxine sodium products is inadequate. AAPS J. 2005 Mar 30;7(1):E42-6. | ||||
| Ref 539702 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2637). | ||||
| Ref 527532 | J Med Chem. 2005 May 5;48(9):3114-7.Thyroid receptor ligands. 3. Design and synthesis of 3,5-dihalo-4-alkoxyphenylalkanoic acids as indirect antagonists of the thyroid hormone receptor. | ||||
| Ref 527923 | Bioorg Med Chem Lett. 2006 Mar 1;16(5):1240-4. Epub 2005 Dec 9.Thyroid receptor ligands. Part 5: novel bicyclic agonist ligands selective for the thyroid hormone receptor beta. | ||||
| Ref 528640 | Bioorg Med Chem Lett. 2007 Apr 1;17(7):2018-21. Epub 2007 Jan 13.Thyroid receptor ligands. Part 7: Indirect antagonists of the thyroid hormone receptor with improved affinity. | ||||
| Ref 529081 | J Med Chem. 2007 Nov 1;50(22):5269-80. Epub 2007 Oct 5.Inhibitors of the interaction of a thyroid hormone receptor and coactivators: preliminary structure-activity relationships. | ||||
| Ref 531482 | Binding of 3,5,3'-triiodothyronine (T3) and its analogs to the in vitro translational products of c-erbA protooncogenes: differences in the affinity of the alpha- and beta-forms for the acetic acid analog and failure of the human testis and kidney alpha-2 products to bind T3. Mol Endocrinol. 1990 Feb;4(2):227-34. | ||||
| Ref 536362 | Thyroid hormone receptors in brain development and function. Nat Clin Pract Endocrinol Metab. 2007 Mar;3(3):249-59. | ||||
| Ref 536494 | Evaluation of thyroid hormone action in a case of generalized resistance to thyroid hormone with chronic thyroiditis: discovery of a novel heterozygous missense mutation (G347A). Endocr J. 2007 Dec;54(5):727-32. Epub 2007 Sep 7. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
