Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T82078
|
||||
| Former ID |
TTDR00813
|
||||
| Target Name |
Toll-like receptor 2
|
||||
| Gene Name |
TLR2
|
||||
| Synonyms |
TLR2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Myelodysplastic syndrome [ICD9: 238.7; ICD10: D46] | |||||
| Melanoma [ICD9: 172; ICD10: C43] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Radiation sickness [ICD9: 990; ICD10: T66] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also promote apoptosis in response to lipoproteins. Recognizes mycoplasmalmacrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6.
|
||||
| BioChemical Class |
Toll-like receptor family
|
||||
| UniProt ID | |||||
| Sequence |
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFS ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA AIKS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Cadi-05 | Drug Info | Phase 3 | Prostate cancer | [522525] |
| MCS-18 | Drug Info | Phase 2 | Autoimmune diabetes | [529495] | |
| OPN-305 | Drug Info | Phase 2 | Myelodysplastic syndrome | [524216] | |
| Lipoteichoic acid | Drug Info | Phase 1/2 | Solid tumours | [548348] | |
| MALP-2S | Drug Info | Phase 1/2 | Pancreatic cancer | [528971] | |
| OM-174 | Drug Info | Phase 1 | Cancer | [524222] | |
| F-50040 | Drug Info | Discontinued in Phase 1 | Melanoma | [547414] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Phagosome | ||||
| PI3K-Akt signaling pathway | |||||
| Toll-like receptor signaling pathway | |||||
| Legionellosis | |||||
| Leishmaniasis | |||||
| Chagas disease (American trypanosomiasis) | |||||
| Malaria | |||||
| Toxoplasmosis | |||||
| Amoebiasis | |||||
| Tuberculosis | |||||
| Hepatitis B | |||||
| Measles | |||||
| Herpes simplex infection | |||||
| Proteoglycans in cancer | |||||
| Inflammatory bowel disease (IBD) | |||||
| Rheumatoid arthritis | |||||
| NetPath Pathway | IL4 Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| PANTHER Pathway | Toll receptor signaling pathway | ||||
| Pathway Interaction Database | Endogenous TLR signaling | ||||
| Reactome | Beta defensins | ||||
| Mal cascade initiated on plasma membrane | |||||
| TLR2 Cascade | |||||
| MyD88 deficiency (TLR2/4) | |||||
| IRAK4 deficiency (TLR2/4) | |||||
| WikiPathways | Toll-like receptor signaling pathway | ||||
| IL1 and megakaryotyces in obesity | |||||
| Human Complement System | |||||
| Toll-Like Receptors Cascades | |||||
| Mal cascade initiated on plasma membrane | |||||
| Defensins | |||||
| Regulation of toll-like receptor signaling pathway | |||||
| References | |||||
| Ref 522525 | ClinicalTrials.gov (NCT00810849) A Trial of Adjunctive Prednisolone and Mycobacterium w Immunotherapy in Tuberculous Pericarditis. U.S. National Institutes of Health. | ||||
| Ref 524216 | ClinicalTrials.gov (NCT01794663) Placebo-Controlled Study to Evaluate the Safety and Efficacy of OPN-305 in Preventing Delayed Renal Graft Function. U.S. National Institutes of Health. | ||||
| Ref 524222 | ClinicalTrials.gov (NCT01800812) Effects of OM-174 in Adult Patients With Solid Tumors. U.S. National Institutes of Health. | ||||
| Ref 528971 | Intratumoural injection of the toll-like receptor-2/6 agonist 'macrophage-activating lipopeptide-2' in patients with pancreatic carcinoma: a phase I/II trial. Br J Cancer. 2007 Sep 3;97(5):598-604. Epub 2007 Jul 31. | ||||
| Ref 529495 | The novel arthritis-drug substance MCS-18 attenuates the antibody production in vivo. Acta Microbiol Immunol Hung. 2008 Mar;55(1):15-31. | ||||
| Ref 526271 | Stability and CTL-activity of P40/ELA melanoma vaccine candidate. Biologicals. 2001 Sep-Dec;29(3-4):293-8. | ||||
| Ref 526545 | Lipoteichoic acid (LTA) of Streptococcus pneumoniae and Staphylococcus aureus activates immune cells via Toll-like receptor (TLR)-2, lipopolysaccharide-binding protein (LBP), and CD14, whereas TLR-4 and MD-2 are not involved. J Biol Chem. 2003 May 2;278(18):15587-94. Epub 2003 Feb 19. | ||||
| Ref 529495 | The novel arthritis-drug substance MCS-18 attenuates the antibody production in vivo. Acta Microbiol Immunol Hung. 2008 Mar;55(1):15-31. | ||||
| Ref 531307 | Failure of mycoplasma lipoprotein MALP-2 to induce NK cell activation through dendritic cell TLR2. Microbes Infect. 2011 Apr;13(4):350-8. | ||||
| Ref 531811 | Treatment with OPN-305, a humanized anti-Toll-Like receptor-2 antibody, reduces myocardial ischemia/reperfusion injury in pigs. Circ Cardiovasc Interv. 2012 Apr;5(2):279-87. | ||||
| Ref 532290 | Phase I study of OM-174, a lipid A analogue, with assessment of immunological response, in patients with refractory solid tumors. BMC Cancer. 2013 Apr 2;13:172. | ||||
| Ref 543472 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1752). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
