Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T89041
|
||||
| Former ID |
TTDS00241
|
||||
| Target Name |
17 alpha-hydroxylase-C17, 20-lyase
|
||||
| Gene Name |
CYP17A1
|
||||
| Synonyms |
17 alpha-Hydroxylase/C17-20-lyase; CYP 17; CYPXVII; P450 17; P450-C17; P450c17; Steroid 17-alpha-hydroxylase/17,20 lyase; CYP17A1
|
||||
| Target Type |
Successful
|
||||
| Disease | Metastatic castration-resistant prostate cancer [ICD9: 140-229, 185; ICD10: C61] | ||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Function |
Conversion of pregnenolone and progesterone to their 17- alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17,20-lyase reaction. Involved in sexual development during fetal life and at puberty.
|
||||
| BioChemical Class |
Oxidoreductases acting on paired donors
|
||||
| Target Validation |
T89041
|
||||
| UniProt ID | |||||
| EC Number |
EC 4.1.2.30
|
||||
| Sequence |
MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKY
GPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIASNNRKGIAFADSGAH WQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVIS LICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRN DLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF GAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREV LRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIP KVVFLIDSFKVKIKVRQAWREAQAEGST |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | ABIRATERONE | Drug Info | Approved | Metastatic castration-resistant prostate cancer | [527863], [531783], [541843] |
| Abiraterone acetate | Drug Info | Approved | Metastatic castration-resistant prostate cancer | [551871] | |
| TAK-700 | Drug Info | Phase 3 | Prostate cancer | [531762] | |
| CFG920 | Drug Info | Phase 1/2 | Metastatic castration-resistant prostate cancer | [532436] | |
| Inhibitor | 1-((9H-Fluoren-2-yl)ethyl)-1H-imidazole | Drug Info | [529625] | ||
| 1-((9H-Fluoren-2-yl)methyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-(1-(4'-Ethylbiphenyl-4-yl)propyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-(1-(4-thiophen-3-yl-phenyl)propyl)-1Himidazole | Drug Info | [529201] | |||
| 1-(1-(4-thiophen-3-ylphenyl)ethyl)-1H-imidazole | Drug Info | [529201] | |||
| 1-(1-(Biphenyl-4-yl)allyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-(1-Biphenyl-4-yl-2-methyl-propyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-(1-Biphenyl-4-yl-2-phenyl-ethyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-(1-Biphenyl-4-yl-3-methyl-butyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-(1-Biphenyl-4-yl-butyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-(1-Biphenyl-4-yl-ethyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-(1-Biphenyl-4-yl-pentyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-(1-Biphenyl-4-yl-propyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-(3,4-dichlorobenzyl)-1H-imidazole | Drug Info | [528225] | |||
| 1-(3,4-difluorobenzyl)-1H-imidazole | Drug Info | [528225] | |||
| 1-(3,5-bis(trifluoromethyl)benzyl)-1H-imidazole | Drug Info | [528225] | |||
| 1-(3,5-dibromobenzyl)-1H-imidazole | Drug Info | [528225] | |||
| 1-(3,5-dichlorobenzyl)-1H-imidazole | Drug Info | [528225] | |||
| 1-(3,5-difluorobenzyl)-1H-imidazole | Drug Info | [528225] | |||
| 1-(3-(4-chlorophenyl)propyl)-1H-imidazole | Drug Info | [528335] | |||
| 1-(3-(4-fluorophenyl)propyl)-1H-imidazole | Drug Info | [528335] | |||
| 1-(3-phenylpropyl)-1H-imidazole | Drug Info | [528335] | |||
| 1-(4-Bromobenzyl)-1H-imidazole | Drug Info | [528335] | |||
| 1-(4-bromophenethyl)-1H-imidazole | Drug Info | [528335] | |||
| 1-(4-chlorobenzyl)-1H-imidazole | Drug Info | [528335] | |||
| 1-(4-chlorophenethyl)-1H-imidazole | Drug Info | [528335] | |||
| 1-(4-fluorobenzyl)-1H-imidazole | Drug Info | [528335] | |||
| 1-(4-iodobenzyl)-1H-imidazole | Drug Info | [531072] | |||
| 1-(4-methyl-benzyl)-1H-imidazole | Drug Info | [528225] | |||
| 1-(4-nitrobenzyl)-1H-imidazole | Drug Info | [528225] | |||
| 1-(Bis-biphenyl-4-yl-methyl)-1H-imidazole | Drug Info | [529625] | |||
| 1-Ethyl-5-(imidazol-1-yl-phenyl-methyl)-1H-indole | Drug Info | [525448] | |||
| 1-Imidazol-1-ylmethyl-4-nitro-xanthen-9-one | Drug Info | [535139] | |||
| 1-Imidazol-1-ylmethylxanthen-9-one | Drug Info | [551345] | |||
| 2,3,4,5-Tetrafluoro-6-pentafluorophenylazo-phenol | Drug Info | [532449] | |||
| 2,3,5,6-Tetrafluoro-4-pentafluorophenylazo-phenol | Drug Info | [532449] | |||
| 2-(1-Imidazol-1-yl-ethyl)-9H-carbazole | Drug Info | [529625] | |||
| 3-(1-Chloro-7-methoxy-naphthalen-2-yl)-pyridine | Drug Info | [527801] | |||
| 3-(1-ethyl-3,4-dihydronaphthalen-2-yl)-pyridine | Drug Info | [528109] | |||
| 3-(1-methyl-3,4-dihydronaphthalen-2-yl)-pyridine | Drug Info | [528109] | |||
| 3-(6-Ethoxy-naphthalen-2-yl)-pyridine | Drug Info | [527801] | |||
| 3-(6-methoxy-3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [528109] | |||
| 3-(6-methoxynaphthalen-2-yl)pyridine | Drug Info | [529834] | |||
| 3-fluoro-4'-(1-(pyridin-4-yl)propyl)biphenyl-4-ol | Drug Info | [530974] | |||
| 3-Fluoro-4'-(pyridin-4-ylmethyl)biphenyl-4-ol | Drug Info | [531085] | |||
| 3-[(4'-Hydroxybiphenyl-4-yl)methyl]pyridine | Drug Info | [531085] | |||
| 3-[4-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [527456] | |||
| 4'-(1-(pyridin-4-yl)propyl)biphenyl-3-ol | Drug Info | [530974] | |||
| 4'-(2-methyl-1-(pyridin-4-yl)propyl)biphenyl-3-ol | Drug Info | [530974] | |||
| 4'-(Pyridin-4-ylmethyl)biphenyl-3,4-diamine | Drug Info | [531085] | |||
| 4'-(Pyridin-4-ylmethyl)biphenyl-3,4-diol | Drug Info | [531085] | |||
| 4'-(Pyridin-4-ylmethyl)biphenyl-3-amine | Drug Info | [531085] | |||
| 4'-(Pyridin-4-ylmethyl)biphenyl-4-amine | Drug Info | [531085] | |||
| 4'-(Pyridin-4-ylmethyl)biphenyl-4-carboxamide | Drug Info | [531085] | |||
| 4-((1H-imidazol-1-yl)methyl)benzonitrile | Drug Info | [528225] | |||
| 4-((1H-imidazol-1-yl)methyl)phenol | Drug Info | [531072] | |||
| 4-((3',4'-Difluorobiphenyl-4-yl)methyl)pyridine | Drug Info | [531085] | |||
| 4-(4'-Fluoro-biphenyl-4-ylmethyl)pyridine | Drug Info | [531085] | |||
| 4-(4-(thiophen-2-yl)benzyl)pyridine | Drug Info | [531085] | |||
| 4-(4-(thiophen-3-yl)benzyl)pyridine | Drug Info | [531085] | |||
| 4-Bromo-1-imidazol-1-ylmethyl-xanthen-9-one | Drug Info | [535139] | |||
| 4-Indan-(1Z)-ylidenemethyl-pyridine | Drug Info | [527456] | |||
| 4-[(3'-Hydroxybiphenyl-4-yl)methyl]pyridine | Drug Info | [531085] | |||
| 4-[(4'-Hydroxybiphenyl-4-yl)methyl]pyridine | Drug Info | [531085] | |||
| 4-[1-(4'-Methoxybiphenyl-4-yl)propyl]pyridine | Drug Info | [531085] | |||
| 4-[4-(6-methoxynaphthalen-2-yl)benzyl]pyridine | Drug Info | [531085] | |||
| 4-[5-Bromo-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [527456] | |||
| 4-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [527456] | |||
| 4-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [527456] | |||
| 4-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [527456] | |||
| 4-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [527456] | |||
| 4-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [527456] | |||
| 5-[4-(Pyridin-4-ylmethyl)phenyl]-1H-indole | Drug Info | [531085] | |||
| 5-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyrimidine | Drug Info | [527456] | |||
| 6-(3-(pyridin-4-yl)phenyl)naphthalen-2-ol | Drug Info | [529160] | |||
| 6-(pyridin-3-yl)-2-naphthonitrile | Drug Info | [529834] | |||
| 6-Pyridin-3-yl-3,4-dihydroquinoline-2(1H)-thione | Drug Info | [529834] | |||
| 6-Pyridin-3-yl-naphthalen-2-ol | Drug Info | [527801] | |||
| 6-[4-(Pyridin-4-ylmethyl)phenyl]naphthalen-2-ol | Drug Info | [531085] | |||
| 7-(1-(1H-imidazol-1-yl)ethyl)-9H-fluoren-2-ol | Drug Info | [529625] | |||
| ANG-3407 | Drug Info | [543411] | |||
| CFG920 | Drug Info | [532436] | |||
| ISOCONAZOLE | Drug Info | [526632] | |||
| N-(4'-Isonicotinoylbiphenyl-3-yl)acetamide | Drug Info | [531085] | |||
| N-3-(4-bromophenyl)propyl imidazole | Drug Info | [528335] | |||
| Rac-4'-(1-Imidazol-1-yl-propyl)-biphenyl-3,4-diol | Drug Info | [529960] | |||
| Rac-4'-(1-Imidazol-1-yl-propyl)-biphenyl-3,5-diol | Drug Info | [529960] | |||
| Rac-4'-(1-Imidazol-1-yl-propyl)-biphenyl-3-ol | Drug Info | [529960] | |||
| Rac-4'-(1-Imidazol-1-yl-propyl)-biphenyl-4-ol | Drug Info | [529960] | |||
| VN/107-1 | Drug Info | [543411] | |||
| Modulator | ABIRATERONE | Drug Info | [527863], [531783] | ||
| Abiraterone acetate | Drug Info | ||||
| TAK-700 | Drug Info | [531762] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Superpathway of steroid hormone biosynthesis | ||||
| Glucocorticoid biosynthesis | |||||
| Androgen biosynthesis | |||||
| KEGG Pathway | Steroid hormone biosynthesis | ||||
| Metabolic pathways | |||||
| Ovarian steroidogenesis | |||||
| Prolactin signaling pathway | |||||
| PathWhiz Pathway | Androgen and Estrogen Metabolism | ||||
| Steroidogenesis | |||||
| Reactome | Androgen biosynthesis | ||||
| Glucocorticoid biosynthesis | |||||
| Endogenous sterols | |||||
| WikiPathways | Metapathway biotransformation | ||||
| Steroid Biosynthesis | |||||
| Oxidation by Cytochrome P450 | |||||
| Metabolism of steroid hormones and vitamin D | |||||
| Glucocorticoid & | |||||
| Mineralcorticoid Metabolism | |||||
| Prostate Cancer | |||||
| Phase 1 - Functionalization of compounds | |||||
| References | |||||
| Ref 527863 | Selective blockade of androgenic steroid synthesis by novel lyase inhibitors as a therapeutic strategy for treating metastatic prostate cancer. BJU Int. 2005 Dec;96(9):1241-6. | ||||
| Ref 531762 | Orteronel (TAK-700), a novel non-steroidal 17,20-lyase inhibitor: effects on steroid synthesis in human and monkey adrenal cells and serum steroid levels in cynomolgus monkeys. J Steroid Biochem Mol Biol. 2012 Apr;129(3-5):115-28. | ||||
| Ref 532436 | Recent progress in pharmaceutical therapies for castration-resistant prostate cancer. Int J Mol Sci. 2013 Jul 4;14(7):13958-78. | ||||
| Ref 525448 | Bioorg Med Chem Lett. 1999 Feb 8;9(3):333-6.New selective nonsteroidal aromatase inhibitors: synthesis and inhibitory activity of 2,3 or 5-(alpha-azolylbenzyl)-1H-indoles. | ||||
| Ref 526632 | J Med Chem. 2003 Jun 5;46(12):2345-51.Three dimensional pharmacophore modeling of human CYP17 inhibitors. Potential agents for prostate cancer therapy. | ||||
| Ref 527456 | J Med Chem. 2005 Mar 10;48(5):1563-75.Synthesis and evaluation of (pyridylmethylene)tetrahydronaphthalenes/-indanes and structurally modified derivatives: potent and selective inhibitors of aldosterone synthase. | ||||
| Ref 527801 | J Med Chem. 2005 Oct 20;48(21):6632-42.Heteroaryl-substituted naphthalenes and structurally modified derivatives: selective inhibitors of CYP11B2 for the treatment of congestive heart failure and myocardial fibrosis. | ||||
| Ref 527863 | Selective blockade of androgenic steroid synthesis by novel lyase inhibitors as a therapeutic strategy for treating metastatic prostate cancer. BJU Int. 2005 Dec;96(9):1241-6. | ||||
| Ref 528109 | J Med Chem. 2006 Apr 6;49(7):2222-31.Synthesis and evaluation of heteroaryl-substituted dihydronaphthalenes and indenes: potent and selective inhibitors of aldosterone synthase (CYP11B2) for the treatment of congestive heart failure and myocardial fibrosis. | ||||
| Ref 528225 | Bioorg Med Chem Lett. 2006 Aug 1;16(15):4011-5. Epub 2006 Jun 5.Synthesis and biochemical evaluation of a range of potent benzyl imidazole-based compounds as potential inhibitors of the enzyme complex 17alpha-hydroxylase/17,20-lyase (P450(17alpha)). | ||||
| Ref 528335 | Bioorg Med Chem Lett. 2006 Sep 15;16(18):4752-6. Epub 2006 Jul 25.Synthesis, biochemical evaluation and rationalisation of the inhibitory activity of a range of 4-substituted phenyl alkyl imidazole-based inhibitors of the enzyme complex 17alpha-hydroxylase/17,20-lyase (P450(17alpha)). | ||||
| Ref 529160 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):267-73. Epub 2007 Oct 30.Synthesis, biological evaluation and molecular modelling studies of novel ACD- and ABD-ring steroidomimetics as inhibitors of CYP17. | ||||
| Ref 529201 | Bioorg Med Chem. 2008 Feb 15;16(4):1992-2010. Epub 2007 Nov 4.Synthesis, biological evaluation and molecular modelling studies of methyleneimidazole substituted biaryls as inhibitors of human 17alpha-hydroxylase-17,20-lyase (CYP17). Part I: Heterocyclic modifications of the core structure. | ||||
| Ref 529625 | Bioorg Med Chem. 2008 Aug 15;16(16):7715-27. Epub 2008 Jul 9.Synthesis, biological evaluation, and molecular modeling studies of methylene imidazole substituted biaryls as inhibitors of human 17alpha-hydroxylase-17,20-lyase (CYP17)--part II: Core rigidification and influence of substituents at the methylene bridge. | ||||
| Ref 529834 | J Med Chem. 2008 Dec 25;51(24):8077-87.In vivo active aldosterone synthase inhibitors with improved selectivity: lead optimization providing a series of pyridine substituted 3,4-dihydro-1H-quinolin-2-one derivatives. | ||||
| Ref 529960 | Eur J Med Chem. 2009 Jul;44(7):2765-75. Epub 2009 Jan 19.Novel CYP17 inhibitors: synthesis, biological evaluation, structure-activity relationships and modelling of methoxy- and hydroxy-substituted methyleneimidazolyl biphenyls. | ||||
| Ref 530974 | J Med Chem. 2010 Jul 8;53(13):5049-53.Isopropylidene substitution increases activity and selectivity of biphenylmethylene 4-pyridine type CYP17 inhibitors. | ||||
| Ref 531072 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5345-8. Epub 2010 Mar 3.Synthesis and biochemical evaluation of a range of (4-substituted phenyl)sulfonate derivatives of 4-hydroxybenzyl imidazole-based compounds as potent inhibitors of 17alpha-hydroxylase/17,20-lyase (P45017alpha) derived from rat testicular microsomes. | ||||
| Ref 531085 | J Med Chem. 2010 Aug 12;53(15):5749-58.Replacement of imidazolyl by pyridyl in biphenylmethylenes results in selective CYP17 and dual CYP17/CYP11B1 inhibitors for the treatment of prostate cancer. | ||||
| Ref 531762 | Orteronel (TAK-700), a novel non-steroidal 17,20-lyase inhibitor: effects on steroid synthesis in human and monkey adrenal cells and serum steroid levels in cynomolgus monkeys. J Steroid Biochem Mol Biol. 2012 Apr;129(3-5):115-28. | ||||
| Ref 532436 | Recent progress in pharmaceutical therapies for castration-resistant prostate cancer. Int J Mol Sci. 2013 Jul 4;14(7):13958-78. | ||||
| Ref 532449 | J Med Chem. 1990 Sep;33(9):2452-5.Hydroxyperfluoroazobenzenes: novel inhibitors of enzymes of androgen biosynthesis. | ||||
| Ref 535139 | A new class of nonsteroidal aromatase inhibitors: design and synthesis of chromone and xanthone derivatives and inhibition of the P450 enzymes aromatase and 17 alpha-hydroxylase/C17,20-lyase. J Med Chem. 2001 Mar 1;44(5):672-80. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
