Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T90782
|
||||
| Former ID |
TTDR00731
|
||||
| Target Name |
P2Y purinoceptor 6
|
||||
| Gene Name |
P2RY6
|
||||
| Synonyms |
Adenosine P2Y6 receptor; P2Y6; P2RY6
|
||||
| Target Type |
Research
|
||||
| Function |
Receptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T90782
|
||||
| UniProt ID | |||||
| Sequence |
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL FYFTQKKFRRRPHELLQKLTAKWQRQGR |
||||
| Agonist | 2MeSATP | Drug Info | [534141] | ||
| 3-phenacyl-UDP | Drug Info | [528542] | |||
| 5BrUTP | Drug Info | [534141] | |||
| adenosine diphosphate | Drug Info | [534141] | |||
| INS48823 | Drug Info | [528028] | |||
| MRS2693 | Drug Info | [528405] | |||
| MRS2782 | Drug Info | [529505] | |||
| MRS2957 | Drug Info | [530896] | |||
| Rp-5-OMe-UDPalphaB | Drug Info | [532861] | |||
| UDP-beta-S | Drug Info | [528028] | |||
| Up3U | Drug Info | [528028] | |||
| uridine triphosphate | Drug Info | [534141] | |||
| Antagonist | MRS2567 | Drug Info | [527038] | ||
| MRS2578 | Drug Info | [527038] | |||
| Inhibitor | PSB-0952 | Drug Info | [530711] | ||
| RB 2 | Drug Info | [530711] | |||
| Pathways | |||||
| References | |||||
| Ref 527038 | Diisothiocyanate derivatives as potent, insurmountable antagonists of P2Y6 nucleotide receptors. Biochem Pharmacol. 2004 May 1;67(9):1763-70. | ||||
| Ref 528028 | P2 receptors activated by uracil nucleotides--an update. Curr Med Chem. 2006;13(3):289-312. | ||||
| Ref 528405 | Structure-activity relationships of uridine 5'-diphosphate analogues at the human P2Y6 receptor. J Med Chem. 2006 Sep 7;49(18):5532-43. | ||||
| Ref 528542 | Synthesis and structure-activity relationships of uracil nucleotide derivatives and analogues as agonists at human P2Y2, P2Y4, and P2Y6 receptors. J Med Chem. 2006 Nov 30;49(24):7076-87. | ||||
| Ref 529505 | Synthesis and potency of novel uracil nucleotides and derivatives as P2Y2 and P2Y6 receptor agonists. Bioorg Med Chem. 2008 Jun 15;16(12):6319-32. | ||||
| Ref 530711 | J Med Chem. 2010 Mar 11;53(5):2076-86.Development of potent and selective inhibitors of ecto-5'-nucleotidase based on an anthraquinone scaffold. | ||||
| Ref 530896 | Pyrimidine ribonucleotides with enhanced selectivity as P2Y(6) receptor agonists: novel 4-alkyloxyimino, (S)-methanocarba, and 5'-triphosphate gamma-ester modifications. J Med Chem. 2010 Jun 10;53(11):4488-501. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
