Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T92463
|
||||
| Former ID |
TTDR01346
|
||||
| Target Name |
mRNA of human RIP2
|
||||
| Gene Name |
RIPK2
|
||||
| Synonyms |
CARD-containing IL-1 beta ICE-kinase (mRNA); CARD-containing interleukin-1 beta-converting enzyme-associated kinase (mRNA); RIP-like-interacting CLARP kinase (mRNA); Receptor-interacting protein 2 (mRNA); Receptor-interacting serine/threonine-protein kinase 2 (mRNA); Tyrosine-protein kinase RIPK2 (mRNA); RIPK2
|
||||
| Target Type |
Research
|
||||
| Function |
Serine/threonine/tyrosine kinase that plays an essential role in modulation of innate and adaptive immune responses. Upon stimulation by bacterial peptidoglycans, NOD1 and NOD2 are activated, oligomerize and recruit RIPK2 through CARD-CARD domains. Contributes to the tyrosine phosphorylation of the guanine exchange factor ARHGEF2 through Src tyrosine kinase leading to NF-kappaB activation by NOD2. Once recruited, RIPK2 autophosphorylates and undergoes 'Lys-63'-linked polyubiquitination by E3 ubiquitin ligases XIAP, BIRC2 and BIRC3. The polyubiquitinated protein mediates the recruitment of MAP3K7/TAK1 to IKBKG/NEMO and induces 'Lys-63'-linkedpolyubiquitination of IKBKG/NEMO and subsequent activation of IKBKB/IKKB. In turn, NF-kappa-B is released from NF-kappa-B inhibitors and translocates into the nucleus where it activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Plays also a role during engagement of the T-cell receptor (TCR) in promoting BCL10 phosphorylation and subsequent NF-kappa-B activation.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T92463
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.2
|
||||
| Sequence |
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET SRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTK PTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM |
||||
| Pathways | |||||
| KEGG Pathway | NOD-like receptor signaling pathway | ||||
| Neurotrophin signaling pathway | |||||
| Shigellosis | |||||
| Tuberculosis | |||||
| NetPath Pathway | IL4 Signaling Pathway | ||||
| TNFalpha Signaling Pathway | |||||
| Pathway Interaction Database | Canonical NF-kappaB pathway | ||||
| IL12-mediated signaling events | |||||
| p75(NTR)-mediated signaling | |||||
| Reactome | NOD1/2 Signaling Pathway | ||||
| p75NTR recruits signalling complexes | |||||
| TAK1 activates NFkB by phosphorylation and activation of IKKs complex | |||||
| Interleukin-1 signaling | |||||
| activated TAK1 mediates p38 MAPK activation | |||||
| JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 | |||||
| WikiPathways | TCR Signaling Pathway | ||||
| FAS pathway and Stress induction of HSP regulation | |||||
| Apoptosis-related network due to altered Notch3 in ovarian cancer | |||||
| MAP kinase activation in TLR cascade | |||||
| Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways | |||||
| TAK1 activates NFkB by phosphorylation and activation of IKKs complex | |||||
| Signalling by NGF | |||||
| TCR signaling | |||||
| Interleukin-1 signaling | |||||
| NOD pathway | |||||
| References | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
