Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T92828
|
||||
| Former ID |
TTDS00199
|
||||
| Target Name |
Endothelin B receptor
|
||||
| Gene Name |
EDNRB
|
||||
| Synonyms |
ET-B; Endothelin receptor B; Endothelin receptor Non-selective type; EDNRB
|
||||
| Target Type |
Successful
|
||||
| Disease | Arrhythmia [ICD9: 427; ICD10: I47-I49] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
| Pulmonary arterial hypertension [ICD9: 416; ICD10: I27.0, I27.2] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Non-specific receptor for endothelin 1, 2, and3. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T92828
|
||||
| UniProt ID | |||||
| Sequence |
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC LKFKANDHGYDNFRSSNKYSSS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Bosentan | Drug Info | Approved | Pulmonary arterial hypertension | [537041], [540432] |
| Macitentan | Drug Info | Approved | Cardiovascular disorder | [532651], [542373], [551871] | |
| PD-145065 | Drug Info | Phase 2 | Hypertension | [533860] | |
| SPI-1620 | Drug Info | Phase 2 | Cancer | [540532], [545629] | |
| BQ788 | Drug Info | Phase 1 | Hypertension | [521960], [538618] | |
| ET-1 | Drug Info | Phase 0 | Discovery agent | [524736], [543350] | |
| ENRASENTAN | Drug Info | Discontinued in Phase 2 | Pulmonary arterial hypertension | [545770] | |
| J-104132 | Drug Info | Discontinued in Phase 2 | Pulmonary arterial hypertension | [546841] | |
| SB-209670 | Drug Info | Discontinued in Phase 2 | Arrhythmia | [540461], [545631] | |
| IRL-2500 | Drug Info | Terminated | Discovery agent | [540533], [546095] | |
| PD142893 | Drug Info | Terminated | Discovery agent | [545245] | |
| RES-701-1 | Drug Info | Terminated | Discovery agent | [540541], [546314] | |
| Antagonist | A192621 | Drug Info | [525580] | ||
| BQ788 | Drug Info | [534868] | |||
| LU302872 | Drug Info | [535544] | |||
| PD142893 | Drug Info | [535521] | |||
| Ro 46-8443 | Drug Info | [543574] | |||
| Sarafotoxin 6C | Drug Info | [535521] | |||
| Inhibitor | Ac-bhg-F-N-Y-Y-W | Drug Info | [551298] | ||
| Ac-w-F-F-N-Y-Y-W | Drug Info | [551298] | |||
| Bhg-F-N-Y-Y-W | Drug Info | [551298] | |||
| Compound ET-3 | Drug Info | [551320] | |||
| Compound RES-701-1(1-10)/[A15]ET-1 | Drug Info | [551320] | |||
| Compound RES-701-1(1-10)/[A15]ET-3 | Drug Info | [551320] | |||
| Compound RES-701-1(1-10)/[A15]SRTX6b | Drug Info | [551320] | |||
| Compound SRTX6b | Drug Info | [551320] | |||
| Compound [S15]ET-1 | Drug Info | [551320] | |||
| Endothelin-3 | Drug Info | [529789] | |||
| ET-1 | Drug Info | [551305] | |||
| IRL-1722 | Drug Info | [551305] | |||
| IRL-1841 | Drug Info | [551305] | |||
| IRL-2500 | Drug Info | [551305] | |||
| Linear peptide of RES-701-1 | Drug Info | [551320] | |||
| PD-163140 | Drug Info | [551335] | |||
| RES-701-1 | Drug Info | [551320] | |||
| RES-701-1-C-terminal analogue | Drug Info | [551314] | |||
| Trp-Ile-Ile-Asp-Leu-Hisc(Cys-Ser-Val-Tyr-Phe-Cys) | Drug Info | [551271] | |||
| Trp-Ile-Ile-Asp-Leu-Hisc(Cys-Val-Tyr-Phe-Cys) | Drug Info | [551271] | |||
| W-F-F-N--Y-Y-W | Drug Info | [551298] | |||
| Modulator | Bosentan | Drug Info | [556264] | ||
| ENDG-4010 | Drug Info | [543574] | |||
| ENRASENTAN | Drug Info | [526546] | |||
| J-104132 | Drug Info | [525496] | |||
| Macitentan | Drug Info | [532651] | |||
| PD-145065 | Drug Info | [533860] | |||
| SB-209670 | Drug Info | [534175] | |||
| Agonist | BQ 3020 | Drug Info | [533714] | ||
| SPI-1620 | Drug Info | [551587], [551698] | |||
| [125I]IRL1620 | Drug Info | [543574] | |||
| Pathways | |||||
| KEGG Pathway | Calcium signaling pathway | ||||
| cGMP-PKG signaling pathway | |||||
| Neuroactive ligand-receptor interaction | |||||
| Melanogenesis | |||||
| Pathways in cancer | |||||
| PANTHER Pathway | Endothelin signaling pathway | ||||
| Pathway Interaction Database | Endothelins | ||||
| Arf6 trafficking events | |||||
| Reactome | Peptide ligand-binding receptors | ||||
| G alpha (q) signalling events | |||||
| WikiPathways | Prostaglandin Synthesis and Regulation | ||||
| GPCRs, Class A Rhodopsin-like | |||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| Peptide GPCRs | |||||
| Endothelin Pathways | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 521960 | ClinicalTrials.gov (NCT00427232) Endothelin-Receptor Blockade in Coronary Heart Disease. U.S. National Institutes of Health. | ||||
| Ref 524736 | ClinicalTrials.gov (NCT02124824) Contribution of Endothelin-1 to Exercise Intolerance in Heart Failure. U.S. National Institutes of Health. | ||||
| Ref 533860 | Reversal of established responses to endothelin-1 in vivo and in vitro by the endothelin receptor antagonists, BQ-123 and PD 145065. Br J Pharmacol. 1994 May;112(1):207-13. | ||||
| Ref 537041 | Optimizing endothelin receptor antagonist use in the management of pulmonary arterial hypertension. Vasc Health Risk Manag. 2008;4(5):943-52. | ||||
| Ref 538618 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1010). | ||||
| Ref 540432 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3494). | ||||
| Ref 540461 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3528). | ||||
| Ref 540532 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3886). | ||||
| Ref 540533 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3887). | ||||
| Ref 540541 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3911). | ||||
| Ref 542373 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7352). | ||||
| Ref 543350 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 989). | ||||
| Ref 545245 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002573) | ||||
| Ref 545629 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003990) | ||||
| Ref 545631 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003996) | ||||
| Ref 545770 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004637) | ||||
| Ref 546095 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006320) | ||||
| Ref 546314 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007396) | ||||
| Ref 525496 | Pharmacological properties of J-104132 (L-753,037), a potent, orally active, mixed ETA/ETB endothelin receptor antagonist. J Pharmacol Exp Ther. 1999 Jun;289(3):1262-70. | ||||
| Ref 525580 | Pyrrolidine-3-carboxylic acids as endothelin antagonists. 4. Side chain conformational restriction leads to ET(B) selectivity. J Med Chem. 1999 Sep 9;42(18):3668-78. | ||||
| Ref 526546 | Enrasentan, an antagonist of endothelin receptors. Cardiovasc Drug Rev. 2003 Spring;21(1):1-16. | ||||
| Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
| Ref 533714 | Pharmacological differences between rat and human endothelin B receptors. Biochem Biophys Res Commun. 1995 Apr 17;209(2):506-12. | ||||
| Ref 533860 | Reversal of established responses to endothelin-1 in vivo and in vitro by the endothelin receptor antagonists, BQ-123 and PD 145065. Br J Pharmacol. 1994 May;112(1):207-13. | ||||
| Ref 534175 | Effects of the endothelin receptor antagonist, SB 209670, on circulatory failure and organ injury in endotoxic shock in the anaesthetized rat. Br J Pharmacol. 1996 May;118(1):198-204. | ||||
| Ref 534868 | BQ788, an endothelin ET(B) receptor antagonist, attenuates stab wound injury-induced reactive astrocytes in rat brain. Glia. 1999 May;26(3):268-71. | ||||
| Ref 535521 | Human optic nerve head astrocytes as a target for endothelin-1. Invest Ophthalmol Vis Sci. 2002 Aug;43(8):2704-13. | ||||
| Ref 535544 | Influence of endothelin receptor antagonists on myocardial protein kinase C isoforms in uraemic cardiomyopathy. Clin Sci (Lond). 2002 Aug;103 Suppl 48:276S-279S. | ||||
| Ref 543574 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 220). | ||||
| Ref 551271 | Structure-activity relationships in a series of monocyclic endothelin analogues, Bioorg. Med. Chem. Lett. 4(4):567-572 (1994). | ||||
| Ref 551298 | Res-701-1, synthesis and a reevaluation of its effects on the endothelin receptors, Bioorg. Med. Chem. Lett. 5(6):621-626 (1995). | ||||
| Ref 551305 | IRL 2500: A potent ETB selective endothelin antagonist, Bioorg. Med. Chem. Lett. 6(19):2323-2328 (1996). | ||||
| Ref 551314 | Analogs of an endothelin antagonist RES-701-1: substitutions of C-terminal amino acid, Bioorg. Med. Chem. Lett. 6(7):775-778 (1996). | ||||
| Ref 551320 | RES-701-1/endothelin-1 hybrid peptide having a potent binding activity for type B receptor, Bioorg. Med. Chem. Lett. 7(13):1715-1720 (1997). | ||||
| Ref 551335 | gamma-Carbamate butenolide analogues as potent ETA selective endothelin receptor antagonists and prodrugs, Bioorg. Med. Chem. Lett. 7(3):297-302 (1997). | ||||
| Ref 551587 | The efficacy and tolerability of two novel H(1)/H(3) receptor antagonists in seasonal allergic rhinitis. Int Arch Allergy Immunol. 2012;158(1):84-98. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
