Target General Infomation
Target ID
T95400
Former ID
TTDS00484
Target Name
High affinity immunoglobulin epsilon receptor
Gene Name
FCER1G
Synonyms
Fc-epsilon RI-gamma; FceRI gamma; IgE Fc receptor subunit gamma; FCER1G
Target Type
Successful
Disease Asthma; Chronic idiopathic urticaria [ICD10: J45, L50]
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99]
Chronic idiopathic urticaria [ICD9: 708; ICD10: L50]
Function
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
UniProt ID
Sequence
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ
Drugs and Mode of Action
Drug(s) Benzylpenicilloyl Polylysine Drug Info Approved Bacterial infections [551871], [552006]
Omalizumab Drug Info Approved Asthma; Chronic idiopathic urticaria [536361], [541948], [889349], [889383]
Omalizumab Drug Info Phase 2 Chronic idiopathic urticaria [536361], [541948]
Inhibitor Alpha-D-Mannose Drug Info [551393]
Fucose Drug Info [551393]
Binder Benzylpenicilloyl Polylysine Drug Info [537823]
Modulator Omalizumab Drug Info [889443]
Pathways
KEGG Pathway Sphingolipid signaling pathway
Fc epsilon RI signaling pathway
Asthma
PathWhiz Pathway Fc Epsilon Receptor I Signaling in Mast Cells
Reactome Fc epsilon receptor (FCERI) signaling
Role of LAT2/NTAL/LAB on calcium mobilization
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
FCERI mediated NF-kB activation
WikiPathways IL1 and megakaryotyces in obesity
Fc epsilon receptor (FCERI) signaling
References
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 541948(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6890).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 552006Drug information of Benzylpenicilloyl Polylysine, 2008. eduDrugs.
Ref 889349ClinicalTrials.gov (NCT00546143) Safety and Tolerability of Omalizumab in Patients With Mild to Moderate Asthma
Ref 889383ClinicalTrials.gov (NCT01701583) Effect of Omalizumab (Xolair) on Basophils in Patients With Chronic Idiopathic Urticaria
Ref 537823Penicillin allergy: anti-penicillin IgE antibodies and immediate hypersensitivity skin reactions employing major and minor determinants of penicillin. Arch Dis Child. 1980 Nov;55(11):857-60.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 889443The potential of biologics for the treatment of asthma. Nat Rev Drug Discov. 2012 Dec;11(12):958-72. doi: 10.1038/nrd3792.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.