Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T95400
|
||||
| Former ID |
TTDS00484
|
||||
| Target Name |
High affinity immunoglobulin epsilon receptor
|
||||
| Gene Name |
FCER1G
|
||||
| Synonyms |
Fc-epsilon RI-gamma; FceRI gamma; IgE Fc receptor subunit gamma; FCER1G
|
||||
| Target Type |
Successful
|
||||
| Disease | Asthma; Chronic idiopathic urticaria [ICD10: J45, L50] | ||||
| Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | |||||
| Chronic idiopathic urticaria [ICD9: 708; ICD10: L50] | |||||
| Function |
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
|
||||
| UniProt ID | |||||
| Sequence |
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| KEGG Pathway | Sphingolipid signaling pathway | ||||
| Fc epsilon RI signaling pathway | |||||
| Asthma | |||||
| PathWhiz Pathway | Fc Epsilon Receptor I Signaling in Mast Cells | ||||
| Reactome | Fc epsilon receptor (FCERI) signaling | ||||
| Role of LAT2/NTAL/LAB on calcium mobilization | |||||
| FCERI mediated MAPK activation | |||||
| FCERI mediated Ca+2 mobilization | |||||
| FCERI mediated NF-kB activation | |||||
| WikiPathways | IL1 and megakaryotyces in obesity | ||||
| Fc epsilon receptor (FCERI) signaling | |||||
| References | |||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 541948 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6890). | ||||
| Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
