Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T96014
|
||||
| Former ID |
TTDR00662
|
||||
| Target Name |
UDP-glucose 4-epimerase
|
||||
| Gene Name |
GALE
|
||||
| Synonyms |
Galactowaldenase; UDP-galactose4'-epimerase; UDP-galactose4-epimerase; GALE
|
||||
| Target Type |
Research
|
||||
| Function |
Catalyzes twodistinct but analogous reactions: the reversible epimerization of UDP-glucose to UDP-galactose and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N- acetylgalactosamine. The reaction with UDP-Gal plays a critical role in the Leloir pathway of galactose catabolism in which galactose is converted to the glycolytic intermediate glucose 6- phosphate. It contributes to the catabolism of dietary galactose and enables the endogenous biosynthesis of both UDP-Gal and UDP- GalNAc when exogenous sources are limited. Both UDP-sugar interconversions are important in the synthesis of glycoproteins and glycolipids.
|
||||
| BioChemical Class |
Racemases and epimerases
|
||||
| Target Validation |
T96014
|
||||
| UniProt ID | |||||
| EC Number |
EC 5.1.3.2
|
||||
| Sequence |
MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSV
EFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMK AHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNA VLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRD YIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARR EGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA |
||||
| Inhibitor | Glucose-Uridine-C1,5'-Diphosphate | Drug Info | [551393] | ||
| Nicotinamide-Adenine-Dinucleotide | Drug Info | [551393] | |||
| Phenyl-Uridine-5'-Diphosphate | Drug Info | [551393] | |||
| PSAMMAPLIN A | Drug Info | [528426] | |||
| Tetramethylammonium Ion | Drug Info | [551393] | |||
| Uridine Diphosphate Galactose | Drug Info | [551395] | |||
| Uridine-5'-Diphosphate | Drug Info | [551393] | |||
| Uridine-5'-Diphosphate-Mannose | Drug Info | [551393] | |||
| Uridine-Diphosphate-N-Acetylgalactosamine | Drug Info | [551393] | |||
| Uridine-Diphosphate-N-Acetylglucosamine | Drug Info | [551391] | |||
| Pathways | |||||
| BioCyc Pathway | D-galactose degradation V (Leloir pathway) | ||||
| UDP-N-acetyl-D-galactosamine biosynthesis I | |||||
| UDP-N-acetyl-D-galactosamine biosynthesis II | |||||
| KEGG Pathway | Galactose metabolism | ||||
| Amino sugar and nucleotide sugar metabolism | |||||
| Metabolic pathways | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| PANTHER Pathway | Fructose galactose metabolism | ||||
| PathWhiz Pathway | Nucleotide Sugars Metabolism | ||||
| Galactose Metabolism | |||||
| WikiPathways | Metabolism of carbohydrates | ||||
| References | |||||
| Ref 528426 | Bioorg Med Chem Lett. 2006 Nov 15;16(22):5744-7. Epub 2006 Sep 7.Identification of novel inhibitors of UDP-Glc 4'-epimerase, a validated drug target for african sleeping sickness. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
